![Western Blot: ZW10 Antibody [NBP2-38751] - Analysis using Anti-ZW10 antibody NBP2-38751 (A) shows similar pattern to independent antibody NBP2-38644 (B).](http://images.novusbio.com/fullsize/ZW10-Antibody-Western-Blot-NBP2-38751-img0006.jpg "Western Blot: ZW10 Antibody [NBP2-38751] - Analysis using Anti-ZW10 antibody NBP2-38751 (A) shows similar pattern to independent antibody NBP2-38644 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KGEVCNMISKKYSEFLPSMQSAQGLITQVDKLSEDIDLLKSRIESEVRRDLHVSTGEFTDLKQQLERDSVVLSLLKQLQEFSTAIEEYNCALTEKKYVTG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZW10 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ZW10 Antibody (NBP2-38751)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ZW10 Antibody [NBP2-38751] - Staining in human testis and skeletal muscle tissues using anti-ZW10 antibody. Corresponding ZW10 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ZW10-Antibody-Immunohistochemistry-Paraffin-NBP2-38751-img0005.jpg "Immunohistochemistry-Paraffin: ZW10 Antibody [NBP2-38751] - Staining in human testis and skeletal muscle tissues using anti-ZW10 antibody. Corresponding ZW10 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry: ZW10 Antibody [NBP2-38751] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/ZW10-Antibody-Immunohistochemistry-NBP2-38751-img0001.jpg "Immunohistochemistry: ZW10 Antibody [NBP2-38751] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: ZW10 Antibody [NBP2-38751] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/ZW10-Antibody-Immunohistochemistry-Paraffin-NBP2-38751-img0003.jpg "Immunohistochemistry-Paraffin: ZW10 Antibody [NBP2-38751] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: ZW10 Antibody [NBP2-38751] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/ZW10-Antibody-Immunohistochemistry-Paraffin-NBP2-38751-img0004.jpg "Immunohistochemistry-Paraffin: ZW10 Antibody [NBP2-38751] - Staining of human testis shows high expression.")
![Immunocytochemistry Mxi1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Mxi1_AF4185_Immunocytochemistry__Immunofluorescence_20286.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")