![Immunocytochemistry/Immunofluorescence: KNTC1 Antibody [NBP1-83032] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane, cytosol & actin filaments. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/KNTC1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83032-img0006.jpg "Immunocytochemistry/Immunofluorescence: KNTC1 Antibody [NBP1-83032] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane, cytosol & actin filaments. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VKMLESLLNSMSASVSLQKLCPWFKNDVIPFVRRTVPEGQIILAKWLEQAARNLELTDKANWPENGLQLAEIFFTAEKTDELGLASSWHWISLKDYQNTEEVCQLRTLVNNLR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KNTC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
| Publication using NBP1-83032 | Applications | Species |
|---|---|---|
| Pan W, Wang S, Liu X et al. KNTC1, regulated by HPV E7, inhibits cervical carcinogenesis partially through Smad2 Experimental cell research 2023-02-01 [PMID: 36608837] (IHC-P, Human) Details: Dilution used in IHC-P 1:20 |
IHC-P | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for KNTC1 Antibody (NBP1-83032)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KNTC1 |
![Immunohistochemistry-Paraffin: KNTC1 Antibody [NBP1-83032] - Staining of human tonsil shows weak cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/KNTC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83032-img0010.jpg "Immunohistochemistry-Paraffin: KNTC1 Antibody [NBP1-83032] - Staining of human tonsil shows weak cytoplasmic positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: KNTC1 Antibody [NBP1-83032] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.](http://images.novusbio.com/fullsize/KNTC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83032-img0005.jpg "Immunohistochemistry-Paraffin: KNTC1 Antibody [NBP1-83032] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.")
![Immunohistochemistry-Paraffin: KNTC1 Antibody [NBP1-83032] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/KNTC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83032-img0007.jpg "Immunohistochemistry-Paraffin: KNTC1 Antibody [NBP1-83032] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: KNTC1 Antibody [NBP1-83032] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/KNTC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83032-img0008.jpg "Immunohistochemistry-Paraffin: KNTC1 Antibody [NBP1-83032] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: KNTC1 Antibody [NBP1-83032] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/KNTC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83032-img0009.jpg "Immunohistochemistry-Paraffin: KNTC1 Antibody [NBP1-83032] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry CXCR4 Antibody (44716) [Unconjugated]](https://images.novusbio.com/images2/CXCR4_MAB172_Immunohistochemistry_6955.jpg)
![Neutralization CXCR4 Antibody (44716) [Unconjugated]](https://images.novusbio.com/images2/CXCR4_MAB172_Block_Neutralize_9041.jpg)
![Immunohistochemistry CXCR4 Antibody (44716) [Unconjugated]](https://images.novusbio.com/images2/CXCR4_MAB172_Immunohistochemistry_19917.jpg)
![N/A Osteoprotegerin/TNFRSF11B [Biotin]](https://images.novusbio.com/images2/DATA_Osteoprotegerin_DY805_ELISA_2238.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/CCL27_DCC270_ELISA_54.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/DATA_CCL27_DCC270_ELISA_615.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")