![Western Blot: Bub3 Antibody [NBP1-88517] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/Bub3-Antibody-Western-Blot-NBP1-88517-img0010.jpg "Western Blot: Bub3 Antibody [NBP1-88517] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YQTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSP |
| Predicted Species | Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BUB3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 37 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-88517 | Applications | Species |
|---|---|---|
| Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012-04-03 [PMID: 22361696] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Bub3 Antibody (NBP1-88517)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Bub3 Antibody [NBP1-88517] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/Bub3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88517-img0008.jpg "Immunocytochemistry/Immunofluorescence: Bub3 Antibody [NBP1-88517] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: Bub3 Antibody [NBP1-88517] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Bub3-Antibody-Immunohistochemistry-Paraffin-NBP1-88517-img0014.jpg "Immunohistochemistry-Paraffin: Bub3 Antibody [NBP1-88517] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Western Blot: Bub3 Antibody [NBP1-88517] - Analysis in human cell line HEK 293.](http://images.novusbio.com/fullsize/Bub3-Antibody-Western-Blot-NBP1-88517-img0006.jpg "Western Blot: Bub3 Antibody [NBP1-88517] - Analysis in human cell line HEK 293.")
![Western Blot: Bub3 Antibody [NBP1-88517] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Bub3-Antibody-Western-Blot-NBP1-88517-img0007.jpg "Western Blot: Bub3 Antibody [NBP1-88517] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: Bub3 Antibody [NBP1-88517] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/Bub3-Antibody-Immunohistochemistry-Paraffin-NBP1-88517-img0001.jpg "Immunohistochemistry-Paraffin: Bub3 Antibody [NBP1-88517] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: Bub3 Antibody [NBP1-88517] - Staining of human cervix, uterine shows strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/Bub3-Antibody-Immunohistochemistry-Paraffin-NBP1-88517-img0011.jpg "Immunohistochemistry-Paraffin: Bub3 Antibody [NBP1-88517] - Staining of human cervix, uterine shows strong nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: Bub3 Antibody [NBP1-88517] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/Bub3-Antibody-Immunohistochemistry-Paraffin-NBP1-88517-img0012.jpg "Immunohistochemistry-Paraffin: Bub3 Antibody [NBP1-88517] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Bub3 Antibody [NBP1-88517] - Staining of human lymph node shows moderate nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize/Bub3-Antibody-Immunohistochemistry-Paraffin-NBP1-88517-img0013.jpg "Immunohistochemistry-Paraffin: Bub3 Antibody [NBP1-88517] - Staining of human lymph node shows moderate nuclear positivity in germinal center cells.")
![Immunocytochemistry Mxi1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Mxi1_AF4185_Immunocytochemistry__Immunofluorescence_20286.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")