![Knockdown Validated: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Quantification of Dynactin-2 knockdown in HeLa cells by Western Blot. Western blots were cropped as indicated (black boxes). For all samples, SDS-PAGE and Western blotting were performed under the same experimental conditions. n:20 for each condition. * = p < 0.05; ** = p < 0.01. Scale bar 10 um. Error bars represent SEM. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/srep08389) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Dynactin-Subunit-2-DCTN2-DCTN-50-Antibody-Knockdown-Validated-NBP1-85277-img0017.jpg "Knockdown Validated: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Quantification of Dynactin-2 knockdown in HeLa cells by Western Blot. Western blots were cropped as indicated (black boxes). For all samples, SDS-PAGE and Western blotting were performed under the same experimental conditions. n:20 for each condition. * = p < 0.05; ** = p < 0.01. Scale bar 10 um. Error bars represent SEM. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/srep08389) licensed under a CC-BY license.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DCTN2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF and WB reactivity reported in (PMID: 25669897). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-85277 | Applications | Species |
|---|---|---|
| Morris EJ, Assi K, Salh B, Dedhar S. Integrin-Linked Kinase links Dynactin-1/Dynactin-2 with cortical Integrin receptors to orient the mitotic spindle relative to the substratum Sci Rep. 2015-02-11 [PMID: 25669897] (ICC/IF, WB, Human) | ICC/IF, WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DCTN2 |
![Immunocytochemistry/Immunofluorescence: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Dynactin-2 is part of the linker arm for the molecular motor Dynein. ILK and Dynactin-2 colocalize at the basal cortex but not at the spindle. of a metaphase cell. Scale bar 10 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/srep08389) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Dynactin-Subunit-2-DCTN2-DCTN-50-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85277-img0016.jpg "Immunocytochemistry/Immunofluorescence: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Dynactin-2 is part of the linker arm for the molecular motor Dynein. ILK and Dynactin-2 colocalize at the basal cortex but not at the spindle. of a metaphase cell. Scale bar 10 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/srep08389) licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human cerebral cortex, colon, kidney and testis using Anti-DCTN2 antibody NBP1-85277 (A) shows similar protein distribution across tissues to independent antibody NBP1-85278 (B).](http://images.novusbio.com/fullsize/Dynactin-Subunit-2-DCTN2-DCTN-50-Antibody-Immunohistochemistry-Paraffin-NBP1-85277-img0010.jpg "Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human cerebral cortex, colon, kidney and testis using Anti-DCTN2 antibody NBP1-85277 (A) shows similar protein distribution across tissues to independent antibody NBP1-85278 (B).")
![Western Blot: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Analysis using Anti-DCTN2 antibody NBP1-85277 (A) shows similar pattern to independent antibody NBP1-85278 (B).](http://images.novusbio.com/fullsize/Dynactin-Subunit-2-DCTN2-DCTN-50-Antibody-Western-Blot-NBP1-85277-img0011.jpg "Western Blot: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Analysis using Anti-DCTN2 antibody NBP1-85277 (A) shows similar pattern to independent antibody NBP1-85278 (B).")
![Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human kidney.](http://images.novusbio.com/fullsize/Dynactin-Subunit-2-DCTN2-DCTN-50-Antibody-Immunohistochemistry-Paraffin-NBP1-85277-img0015.jpg "Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human kidney.")
![Western Blot: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/Dynactin-Subunit-2-DCTN2-DCTN-50-Antibody-Western-Blot-NBP1-85277-img0009.jpg "Western Blot: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human testis.](http://images.novusbio.com/fullsize/Dynactin-Subunit-2-DCTN2-DCTN-50-Antibody-Immunohistochemistry-Paraffin-NBP1-85277-img0012.jpg "Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human testis.")
![Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/Dynactin-Subunit-2-DCTN2-DCTN-50-Antibody-Immunohistochemistry-Paraffin-NBP1-85277-img0013.jpg "Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human colon.](http://images.novusbio.com/fullsize/Dynactin-Subunit-2-DCTN2-DCTN-50-Antibody-Immunohistochemistry-Paraffin-NBP1-85277-img0014.jpg "Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human colon.")
![Agonist Activity CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD40_AF632_Functional_Assay_15457.jpg)
![Western Blot CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD40_AF632_Western_Blot_20204.jpg)
![Simple Western CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/af632_human-cd40-tnfrsf5-affinity-purified-polyclonal-ab-simple-western-58202111562.jpg)
![Western Blot c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/c-Abl_AF5414_Western_Blot_5714.jpg)
![Simple Western c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/cAbl_AF5414_Simple_Western_17046.jpg)
![Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunocytochemistry__Immunofluorescence_17382.jpg)
![Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunohistochemistry_23316.jpg)
![Knockdown Validated COUP-TF II/NR2F2 Antibody (H7147) [Unconjugated]](https://images.novusbio.com/images/pp-h7147-00_human-coup-tf-ii-nr2f2-mab-clone-h7147-41202412505335.jpg)
![Knockdown Validated COUP-TF II/NR2F2 Antibody (H7147) [Unconjugated]](https://images.novusbio.com/images/pp-h7147-00_human-coup-tf-ii-nr2f2-mab-clone-h7147-41202412505337.jpg)
![Immunohistochemistry Angiopoietin-like Protein 1/ANGPTL1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2204_human-angiopoietin-like-1-affinity-purified-polyclonal-ab-immunohistochemistry-27122022161939.jpg)
![Immunohistochemistry PITX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/PITX2_AF7388_Immunohistochemistry_12162.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")