Genetic Strategies: Knockdown Validated: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Quantification of Dynactin-2 knockdown in HeLa cells by Western Blot. Western blots were cropped as indicated ...read more
Immunocytochemistry/ Immunofluorescence: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Dynactin-2 is part of the linker arm for the molecular motor Dynein. ILK and Dynactin-2 colocalize at the basal cortex ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human cerebral cortex, colon, kidney and testis using Anti-DCTN2 antibody NBP1-85277 (A) ...read more
Independent Antibodies: Western Blot: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Analysis using Anti-DCTN2 antibody NBP1-85277 (A) shows similar pattern to independent antibody NBP1-85278 (B).
Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human kidney.
Western Blot: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human testis.
Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human colon.
This antibody was developed against Recombinant Protein corresponding to amino acids: RWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCTN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Dynactin subunit 2 encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277) (0)
There are no reviews for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Dynactin Subunit 2/DCTN2/DCTN-50 Antibody and receive a gift card or discount.