![Western Blot: STX18 Antibody (2E5) [H00053407-M13] - Analysis of STX18 expression in PC-12 (Cat # L012V1).](http://images.novusbio.com/fullsize/STX18-Antibody-2E5-Western-Blot-H00053407-M13-img0004.jpg "Western Blot: STX18 Antibody (2E5) [H00053407-M13] - Analysis of STX18 expression in PC-12 (Cat # L012V1).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 2E5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | STX18 (NP_058626, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QIFMRTCSEAIQQLRTEAHKEIHSQQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSSEKVSQSPSKDSEENPA |
| Specificity | Reacts with syntaxin 18. |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | STX18 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against cell lysate in western blot and recombinant protein in ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Simple Western Syntaxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin_5_AF5687_Simple_Western_20944.jpg)
![Western Blot Syntaxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin_5_AF5687_Western_Blot_5806.jpg)
![Immunohistochemistry Syntaxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin_5_AF5687_Immunohistochemistry_19570.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: STX18 Antibody (2E5) [H00053407-M13] - Analysis of monoclonal antibody to STX18 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml](http://images.novusbio.com/fullsize/STX18-Antibody-2E5-Immunohistochemistry-Paraffin-H00053407-M13-img0002.jpg "Immunohistochemistry-Paraffin: STX18 Antibody (2E5) [H00053407-M13] - Analysis of monoclonal antibody to STX18 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml")
![Western Blot: STX18 Antibody (2E5) [H00053407-M13] - Analysis of STX18 expression in Raw 264.7 (Cat # L024V1).](http://images.novusbio.com/fullsize/STX18-Antibody-2E5-Western-Blot-H00053407-M13-img0005.jpg "Western Blot: STX18 Antibody (2E5) [H00053407-M13] - Analysis of STX18 expression in Raw 264.7 (Cat # L024V1).")
![Sandwich ELISA: STX18 Antibody (2E5) [H00053407-M13] - Detection limit for recombinant GST tagged STX18 is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/STX18-Antibody-2E5-Sandwich-ELISA-H00053407-M13-img0003.jpg "Sandwich ELISA: STX18 Antibody (2E5) [H00053407-M13] - Detection limit for recombinant GST tagged STX18 is 0.1 ng/ml as a capture antibody.")
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")