Home » IRF7 » IRF7 Antibodies » IRF7 Antibody
Novus Biologicals products are now on bio-techne.com

IRF7 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: IRF7 Antibody [NBP3-35066] - Western blot analysis of lysates from Mouse liver, using IRF7 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.
Western Blot: IRF7 Antibody [NBP3-35066] - Western blot analysis of lysates from Mouse liver, using IRF7 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 ...read more

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals offers 100% Guarantee

IRF7 Antibody Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IRF7 (NP_001563.2).

Sequence:
KDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IRF7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500 - 1:1000
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.05% Proclin 300
Purity
Affinity purified

Alternate Names for IRF7 Antibody

  • interferon regulatory factor 7
  • interferon regulatory factor-7H
  • IRF-7
  • IRF7A
  • IRF-7H

Background

IRF7 encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. Inducible expression of IRF7 is largely restricted to lymphoid tissue. Multiple IRF7 transcript variants have been identified, although the functional consequences of these have not yet been established.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

IFN-alpha 1
Antibody
NBP2-75930
Western Blot IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IRF3 Antibody
(SD2062)
NBP2-67741
Immunocytochemistry/ Immunofluorescence IRF3 Antibody (SD2062)
Immunocytochemistry/ Immunofluorescence IRF3 Antibody (SD2062)
Immunohistochemistry-Paraffin IRF3 Antibody (SD2062)
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MuRF1/TRIM63
Antibody [Unconjugate
AF5366
Western Blot MuRF1/TRIM63 Antibody [Unconjugated]
Simple Western MuRF1/TRIM63 Antibody [Unconjugated]
Western Blot MuRF1/TRIM63 Antibody [Unconjugated]
(26 Publications)
Species: Hu, Mu, Rt
Applications: Simple Western, WB
TLR9 Antibody
(26C593.2) - BSA Free
NBP2-24729
Immunohistochemistry-Paraffin TLR9 Antibody (26C593.2) - BSA Free
Flow Cytometry TLR9 Antibody (26C593.2) - BSA Free
Flow Cytometry TLR9 Antibody (26C593.2) - BSA Free
(4 Reviews)
(159 Publications)
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
IFN-beta
[Unconjugated]
8499-IF
Binding Activity IFN-beta [Unconjugated]
(54 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(824 Publications)
Species: Hu
Applications: BA
TLR7 Antibody -
BSA Free
NBP2-24906
Immunocytochemistry/ Immunofluorescence TLR7 Antibody - BSA Free
Immunohistochemistry-Frozen TLR7 Antibody - BSA Free
Immunohistochemistry TLR7 Antibody - BSA Free
(4 Reviews)
(82 Publications)
Species: Hu, Mu, Rt
Applications: BA, DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Simple Western, WB
IRF1 Antibody
[Unconjugated]
AF4715
Western Blot IRF1 Antibody [Unconjugated]
Western Blot IRF1 Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Mu
Applications: WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
STAT1 [p Tyr701]
Antibody [Unconjugate ...
AF2894
Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]
Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
IRF9 Antibody -
BSA Free
NBP2-16991
Western Blot IRF9 Antibody - BSA Free
Immunohistochemistry-Paraffin IRF9 Antibody - BSA Free
Western Blot IRF9 Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
RIG-I Antibody
AF4859
Western Blot RIG-I Antibody
(2 Publications)
Species: Hu
Applications: WB
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(145 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
TLR3 Antibody
(40C1285.6) - BSA Fre
NBP2-24875
Flow Cytometry TLR3 Antibody (40C1285.6) - BSA Free
Western Blot TLR3 Antibody (40C1285.6) - BSA Free
Flow Cytometry TLR3 Antibody (40C1285.6) - BSA Free
(90 Publications)
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
IRF5 Antibody
NB100-1092
Western Blot IRF5 Antibody
Western Blot IRF5 Antibody
Western Blot IRF5 Antibody
(9 Publications)
Species: Hu, Mu
Applications: ChIP, Flow, KD, PEP-ELISA, WB
MyD88 Inhibitor
Peptide Set
NBP2-29328
MyD88 Inhibitor Peptide Set
(3 Reviews)
(100 Publications)
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
TBK1 Antibody
(108A429) - BSA Free
NB100-56705
Immunohistochemistry-Paraffin TBK1 Antibody (108A429) - BSA Free
Immunocytochemistry/ Immunofluorescence TBK1 Antibody (108A429) - BSA Free
Simple Western TBK1 Antibody (108A429) - BSA Free
(2 Reviews)
(31 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(676 Publications)
Species: Mu
Applications: ELISA
TRIF/TICAM1
Antibody - BSA Free
NB120-13810
Western Blot TRIF/TICAM1 Antibody - BSA Free
Unknown TRIF/TICAM1 Antibody - BSA Free
Immunohistochemistry-Paraffin TRIF/TICAM1 Antibody - BSA Free
(37 Publications)
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
IRF7 Antibody
NBP3-35066
IRF7 Antibody
Species: Mu
Applications: WB, ELISA

Publications for IRF7 Antibody (NBP3-35066) (0)

There are no publications for IRF7 Antibody (NBP3-35066).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF7 Antibody (NBP3-35066) (0)

There are no reviews for IRF7 Antibody (NBP3-35066). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IRF7 Antibody (NBP3-35066) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IRF7 Products

Research Areas for IRF7 Antibody (NBP3-35066)

Find related products by research area.

Blogs on IRF7.

Check out the latest blog posts on IRF7.
TLR7 and Immune Response Regulation
Toll-like receptor 7 (TLR7) is a protein encoded by the TLR7 gene in humans and is a member of TLR family. TLRs controls host immune response against pathogens (e.g. viruses, bacteria and fungi) through recognition of pathogen-associated molecular pat...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRF7 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol IRF7