![Western Blot: USP9x Antibody (7T0S2) [NBP3-16884] - Western blot analysis of extracts of various cell lines, using USP9x Rabbit mAb (NBP3-16884) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/USP9x-Antibody-7T0S2-Western-Blot-NBP3-16884-img0004.jpg "Western Blot: USP9x Antibody (7T0S2) [NBP3-16884] - Western blot analysis of extracts of various cell lines, using USP9x Rabbit mAb (NBP3-16884) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 7T0S2 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP9X (Q93008). MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEA |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | USP9X |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for USP9x Antibody (NBP3-16884)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | USP9X |
![Immunocytochemistry/Immunofluorescence: USP9x Antibody (7T0S2) [NBP3-16884] - Immunofluorescence analysis of NIH-3T3 cells using USP9x Rabbit mAb (NBP3-16884) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/USP9x-Antibody-7T0S2-Immunocytochemistry-Immunofluorescence-NBP3-16884-img0003.jpg "Immunocytochemistry/Immunofluorescence: USP9x Antibody (7T0S2) [NBP3-16884] - Immunofluorescence analysis of NIH-3T3 cells using USP9x Rabbit mAb (NBP3-16884) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: USP9x Antibody (7T0S2) [NBP3-16884] - Immunohistochemistry of paraffin-embedded mouse testis using USP9x Rabbit mAb (NBP3-16884) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/USP9x-Antibody-7T0S2-Immunohistochemistry-Paraffin-NBP3-16884-img0002.jpg "Immunohistochemistry-Paraffin: USP9x Antibody (7T0S2) [NBP3-16884] - Immunohistochemistry of paraffin-embedded mouse testis using USP9x Rabbit mAb (NBP3-16884) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: USP9x Antibody (7T0S2) [NBP3-16884] - Immunohistochemistry of paraffin-embedded rat testis using USP9x Rabbit mAb (NBP3-16884) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/USP9x-Antibody-7T0S2-Immunohistochemistry-Paraffin-NBP3-16884-img0001.jpg "Immunohistochemistry-Paraffin: USP9x Antibody (7T0S2) [NBP3-16884] - Immunohistochemistry of paraffin-embedded rat testis using USP9x Rabbit mAb (NBP3-16884) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Simple Western Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Simple_Western_17259.jpg)
![Western Blot Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Western_Blot_14481.jpg)
![Immunohistochemistry Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Immunohistochemistry_14553.jpg)
![Immunohistochemistry NOV/CCN3 Antibody [Unconjugated]](https://images.novusbio.com/images2/NOV_AF1640_Immunohistochemistry_7314.jpg)
![Immunohistochemistry Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Immunohistochemistry_10417.jpg)
![Immunocytochemistry Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Immunocytochemistry_11095.jpg)
![Western Blot Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Western_Blot_9601.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot IRF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/IRF1_AF4715_Western_Blot_5529.jpg)
![Western Blot IRF1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af4715_mouse-irf1-affinity-purified-polyclonal-ab-western-blot-16122024101037..png)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")