Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ICC/IF, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | Azide and BSA Free |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 2456-2555 of human USP9Y (NP_004645.2). YFLERSHSARMTLAKACELCPEEEPDDQDAPDEHEPSPSEDAPLYPHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSPQMKDQ |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | USP9Y |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS, 50% glycerol, pH7.3 |
Preservative | 0.05% Proclin 300 |
Purity | Affinity purified |
Publication using NBP3-16073 | Applications | Species |
---|---|---|
Gelfand B, Argyle D, Olivieri J, Ambati J Survey of commercial antibodies targeting Y chromosome-encoded genes bioRxiv 2023-07-28 (WB) | WB |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | USP9Y |