![Western Blot: MxA/Mx1 Antibody [NBP1-83120] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-MX1 antibody. Corresponding MX1 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.](http://images.novusbio.com/fullsize/MxA-Mx1-Antibody-Western-Blot-NBP1-83120-img0011.jpg "Western Blot: MxA/Mx1 Antibody [NBP1-83120] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-MX1 antibody. Corresponding MX1 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWDFGAFQSSSATDSS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MX1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ELISA, WB reported in scientific literature (PMID: 25878567). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/PKLR_AF8519_Western_Blot_16592.jpg)
![Simple Western PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/af8519_human-mouse-rat-pklr-affinity-purified-pab-simple-western-1342022154119.jpg)
![Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Western_Blot_5226.jpg)
![Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/16351.jpg)
![Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Flow_Cytometry_8189.jpg)
| Publication using NBP1-83120 | Applications | Species |
|---|---|---|
| Johansson HJ, Sanchez BC, Forshed J et al. Proteomics profiling identify CAPS as a potential predictive marker of tamoxifen resistance in estrogen receptor positive breast cancer. Clin Proteomics 2015-01-01 [PMID: 25878567] (WB, ELISA, Human) | WB, ELISA | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for MxA/Mx1 Antibody (NBP1-83120)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MX1 |
![Western Blot: MxA/Mx1 Antibody [NBP1-83120] - Analysis in human cell line SK-MEL-30 and human cell line A-549.](http://images.novusbio.com/fullsize/MxA-Mx1-Antibody-Western-Blot-NBP1-83120-img0012.jpg "Western Blot: MxA/Mx1 Antibody [NBP1-83120] - Analysis in human cell line SK-MEL-30 and human cell line A-549.")
![Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/MxA-Mx1-Antibody-Immunohistochemistry-Paraffin-NBP1-83120-img0009.jpg "Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/MxA-Mx1-Antibody-Immunohistochemistry-Paraffin-NBP1-83120-img0006.jpg "Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120] - Staining of human skeletal muscle shows no cytoplasmic positivity in striated muscle fibers as expected.](http://images.novusbio.com/fullsize/MxA-Mx1-Antibody-Immunohistochemistry-Paraffin-NBP1-83120-img0007.jpg "Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120] - Staining of human skeletal muscle shows no cytoplasmic positivity in striated muscle fibers as expected.")
![Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120] - Staining of human small intestine shows strong cytoplasmic positivity in glandular as well as lymphoid cells.](http://images.novusbio.com/fullsize/MxA-Mx1-Antibody-Immunohistochemistry-Paraffin-NBP1-83120-img0008.jpg "Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-83120] - Staining of human small intestine shows strong cytoplasmic positivity in glandular as well as lymphoid cells.")
![Binding Activity IFN-beta [Unconjugated]](https://images.novusbio.com/images2/IFNbeta_8499IF_1038.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![ISG15/UCRP [7-Amino-4-Methyl Coumarin]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "ISG15/UCRP [7-Amino-4-Methyl Coumarin]")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Immunocytochemistry__Immunofluorescence_19196.jpg)
![Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Flow_Cytometry_19476.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_723.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_724.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/CXCL10_DIP100_ELISA_121.jpg)
![Western Blot IRF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/IRF1_AF4715_Western_Blot_5529.jpg)
![Western Blot IRF1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af4715_mouse-irf1-affinity-purified-polyclonal-ab-western-blot-16122024101037..png)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")