Western Blot: MX2 Antibody [NBP1-81018] - MX2 is localized to mitochondria in cultured cells. Western blotting of four distinct cell lines comparing endogenous MX2 expression under control conditions vs. treatment with ...read more
Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human spleen shows strong positivity in nuclear membrane in cells in red pulp.
Western Blot: MX2 Antibody [NBP1-81018] - Human glioma U87 cell lysate. WB image submitted by a verified customer review.
Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human liver shows no postivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human colon shows moderate postivity in nuclear membrane in lymphoid cells in the lamina propria.
Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human skeletal muscle shows no postivity in myocytes as expected.
Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human lymph node shows moderate positivity in nuclear membrane in non-germinal center cells.
GPR50 promotes ligand-independent activation of T beta RI signaling. a HEK293T cells expressing myc-Smad3, and GPR50 delta 4 or GPR50wt were starved overnight and stimulated with TGF beta (2 ng/mL; 1 h). Smad3 ...read more
Hypoxia-induced downregulation of gamma -taxilin and alpha NAC and the subsequent ER responses are GSK-3 beta -dependent. (a) GSK-3 beta activation in hypoxia. Western blot analysis shows downregulation of ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunocytochemistry/ Immunofluorescence Reported in literature (PMID: 300848227).
Immunohistochemistry 1:50 - 1:200
Immunohistochemistry-Paraffin 1:50 - 1:200
Western Blot Reactivity reported in (PMID: 30333168), and from a verified customer review
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
82 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for MX2 Antibody
human interferon-regulated resistance GTP-binding protein MXB10Interferon-regulated resistance GTP-binding protein MxB
interferon-induced GTP-binding protein Mx2
MXB
myxovirus (influenza virus) resistance 2 (mouse)
myxovirus (influenza) resistance 2, homolog of murine
Myxovirus resistance protein 2
p78-related protein
second interferon-induced protein p78
Background
MX2 is encoded by this gene has a nuclear and a cytoplasmic form and is a member of both the dynamin family and the family of large GTPases. The nuclear form is localized in a granular pattern in the heterochromatin region beneath the nuclear envelope. A nuclear localization signal (NLS) is present at the amino terminal end of the nuclear form but is lacking in the cytoplasmic form due to use of an alternate translation start codon. This protein is upregulated by interferon-alpha but does not contain the antiviral activity of a similar myxovirus resistance protein 1. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Elias M, Wright S, Remenyi J et al. Massively parallel reporter assays combined with cell-type specific eQTL informed multiple melanoma loci and identified a pleiotropic function of HIV-1 restriction gene, MX2, in melanoma promotion BioRxiv 2019-05-02 (WB, Human)
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.