![Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Analysis in human skeletal muscle and liver tissues using NBP1-85788 antibody. Corresponding MEF2D RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MEF2D-Antibody-Immunohistochemistry-Paraffin-NBP1-85788-img0022.jpg "Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Analysis in human skeletal muscle and liver tissues using NBP1-85788 antibody. Corresponding MEF2D RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MEF2D |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. MEF2D antibody validated for ELISA from a verified customer review. In Simple Western internal validation: Mouse Brain lysate as sample; separated by size; antibody dilution of 1:50 - 1:1000; matrix was 12-230 kDa; detected by Chemiluminescence. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
ELISA | Human and Mouse | 06/05/2018 |
Summary
|
||||||||
Enlarge |
reviewed by:
Verified Customer |
Simple Western | Mouse | 03/25/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for MEF2D Antibody (NBP1-85788)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 06/05/2018 |
||
| Application: | ELISA | |
| Species: | Human and Mouse |
| Verified Customer 03/25/2016 |
||
| Application: | Simple Western | |
| Species: | Mouse |
| Gene Symbol | MEF2D |
![Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human kidney, liver, placenta and skeletal muscle using Anti-MEF2D antibody NBP1-85788 (A) shows similar protein distribution across tissues to independent antibody NBP1-85795 (B).](http://images.novusbio.com/fullsize/MEF2D-Antibody-Immunohistochemistry-Paraffin-NBP1-85788-img0018.jpg "Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human kidney, liver, placenta and skeletal muscle using Anti-MEF2D antibody NBP1-85788 (A) shows similar protein distribution across tissues to independent antibody NBP1-85795 (B).")
![Western Blot: MEF2D Antibody [NBP1-85788] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/MEF2D-Antibody-Western-Blot-NBP1-85788-img0007.jpg "Western Blot: MEF2D Antibody [NBP1-85788] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunocytochemistry/Immunofluorescence: MEF2D Antibody [NBP1-85788] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/MEF2D-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85788-img0008.jpg "Immunocytochemistry/Immunofluorescence: MEF2D Antibody [NBP1-85788] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human kidney shows strong nuclear postivity in cells in glomeruli.](http://images.novusbio.com/fullsize/MEF2D-Antibody-Immunohistochemistry-Paraffin-NBP1-85788-img0025.jpg "Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human kidney shows strong nuclear postivity in cells in glomeruli.")
![Western Blot: MEF2D Antibody [NBP1-85788] - Analysis in human cell line THP-1.](http://images.novusbio.com/fullsize/MEF2D-Antibody-Western-Blot-NBP1-85788-img0006.jpg "Western Blot: MEF2D Antibody [NBP1-85788] - Analysis in human cell line THP-1.")
![Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/MEF2D-Antibody-Immunohistochemistry-Paraffin-NBP1-85788-img0020.jpg "Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.](http://images.novusbio.com/fullsize/MEF2D-Antibody-Immunohistochemistry-Paraffin-NBP1-85788-img0023.jpg "Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.")
![Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/MEF2D-Antibody-Immunohistochemistry-Paraffin-NBP1-85788-img0024.jpg "Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.")
![ELISA: MEF2D Antibody [NBP1-85788] - Lysates from NIH3T3 and SVG-A cells assessed by ELISA, loading the indicated mass of total protein per well. Antibody was diluted 1:250, and used in conjunction with an HRP-conjugated secondary antibody. Signal was detected by luminescence. Image from verified customer review.](http://images.novusbio.com/fullsize/MEF2D-Antibody-ELISA-NBP1-85788-img0013.jpg "ELISA: MEF2D Antibody [NBP1-85788] - Lysates from NIH3T3 and SVG-A cells assessed by ELISA, loading the indicated mass of total protein per well. Antibody was diluted 1:250, and used in conjunction with an HRP-conjugated secondary antibody. Signal was detected by luminescence. Image from verified customer review.")
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot ERK5/BMK1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK5_AF2848_Western_Blot_5217.jpg)
![Immunocytochemistry ERK5/BMK1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK5_AF2848_Immunocytochemistry__Immunofluorescence_19361.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Western_Blot_5219.jpg)
![Simple Western AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Simple_Western_16678.jpg)
![Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Immunocytochemistry__Immunofluorescence_19686.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
