![Western Blot: Glut2 Antibody [NBP1-69466] - Humna fetal liver tissue lysate at 1ug/ml.](http://images.novusbio.com/fullsize/Glut2-Antibody-Western-Blot-NBP1-69466-img0004.jpg "Western Blot: Glut2 Antibody [NBP1-69466] - Humna fetal liver tissue lysate at 1ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to SLC2A2(solute carrier family 2 (facilitated glucose transporter), member 2) The peptide sequence was selected from the N terminal of human SLC2A2. Peptide sequence ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINST The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC2A2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 58 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Publication using NBP1-69466 | Applications | Species |
|---|---|---|
| Deka B, Sarma P, Manna P et al. Alliin Enriched Standardized Fraction of Allium Hookeri Regulates the Glucose Homeostasis Via Upregulating Hepatic Glutathione Pool SSRN Electronic Journal 2023-02-17 (WB, Rat) | WB | Rat |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Jennifer McGuire |
WB | Pig and Rat | 07/24/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Glut2 Antibody (NBP1-69466)Find related products by research area.
|
|
Deficiency of GluT1 leads to neurological problems while excess is involved in cancers By Jamshed Arslan, Pharm. D., PhD. What Are GluTs?Mammalian cell metabolism is incomplete without glucose . Glucose is a monosaccharide that is transported to the cells through facilitative diffusion, a ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Glut2 Antibody [NBP1-69466] - Human fetal lung, Lane A: Primary antibody, Lane B: Primary antibody + blocking peptide. Primary antibody at 1ug/ml, Peptide at 5ug/ml, Lysate: 25ug/lane, Gel: 0.12%.](http://images.novusbio.com/fullsize/Glut2-Antibody-Western-Blot-NBP1-69466-img0003.jpg "Western Blot: Glut2 Antibody [NBP1-69466] - Human fetal lung, Lane A: Primary antibody, Lane B: Primary antibody + blocking peptide. Primary antibody at 1ug/ml, Peptide at 5ug/ml, Lysate: 25ug/lane, Gel: 0.12%.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot PDX-1/IPF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PDX-1_AF2419_Western_Blot_5187.jpg)
![Immunocytochemistry PDX-1/IPF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PDX1_AF2419_Immunocytochemistry_16575.jpg)
![Simple Western PDX-1/IPF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PDX1_AF2419_Simple_Western_16996.jpg)
![Flow Cytometry Glut3 Antibody (202017) [Unconjugated]](https://images.novusbio.com/images2/Glut3_MAB1415_Flow_Cytometry_19979.jpg)
![Immunocytochemistry Glut3 Antibody (202017) [Unconjugated]](https://images.novusbio.com/images2/Glut3_MAB1415_Immunocytochemistry__Immunofluorescence_20431.jpg)
![Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Immunocytochemistry_6560.jpg)
![Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Flow_Cytometry_20264.jpg)
![Western Blot IRS2 Antibody (676415) [Unconjugated]](https://images.novusbio.com/images2/IRS2_MAB6347_Western_Blot_11857.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
