![Immunohistochemistry-Paraffin: CRLF3 Antibody [NBP1-84382] - Staining in human lymph node and pancreas tissues using anti-CRLF3 antibody. Corresponding CRLF3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CRLF3-Antibody-Immunohistochemistry-Paraffin-NBP1-84382-img0009.jpg "Immunohistochemistry-Paraffin: CRLF3 Antibody [NBP1-84382] - Staining in human lymph node and pancreas tissues using anti-CRLF3 antibody. Corresponding CRLF3 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IEHGVNTAEDLVREGEIAMLGGVGEENEKLWSFTKKASHIQLDSLPEVPLLVDVPCLSAQLDDSILNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWCKVDDDFTAQDYRLQFRKCTSNHFEDVYVGSE |
| Predicted Species | Mouse (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CRLF3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Western_Blot_5226.jpg)
![Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/16351.jpg)
![Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Flow_Cytometry_8189.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CRLF3 Antibody (NBP1-84382)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CRLF3 |
![Western Blot: CRLF3 Antibody [NBP1-84382] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/CRLF3-Antibody-Western-Blot-NBP1-84382-img0011.jpg "Western Blot: CRLF3 Antibody [NBP1-84382] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Immunocytochemistry/Immunofluorescence: CRLF3 Antibody [NBP1-84382] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.](http://images.novusbio.com/fullsize/CRLF3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84382-img0006.jpg "Immunocytochemistry/Immunofluorescence: CRLF3 Antibody [NBP1-84382] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.")
![Western Blot: CRLF3 Antibody [NBP1-84382] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/CRLF3-Antibody-Western-Blot-NBP1-84382-img0005.jpg "Western Blot: CRLF3 Antibody [NBP1-84382] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Immunohistochemistry-Paraffin: CRLF3 Antibody [NBP1-84382] - Staining of human lymph node shows high expression.](http://images.novusbio.com/fullsize/CRLF3-Antibody-Immunohistochemistry-Paraffin-NBP1-84382-img0007.jpg "Immunohistochemistry-Paraffin: CRLF3 Antibody [NBP1-84382] - Staining of human lymph node shows high expression.")
![Immunohistochemistry-Paraffin: CRLF3 Antibody [NBP1-84382] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/CRLF3-Antibody-Immunohistochemistry-Paraffin-NBP1-84382-img0008.jpg "Immunohistochemistry-Paraffin: CRLF3 Antibody [NBP1-84382] - Staining of human pancreas shows low expression as expected.")
![Simple Western STAT2 [p Tyr690] Antibody (1021D) [Unconjugated]](https://images.novusbio.com/images2/16353.jpg)
![Flow Cytometry STAT2 [p Tyr690] Antibody (1021D) [Unconjugated]](https://images.novusbio.com/images2/STAT2_MAB2890_Flow_Cytometry_18682.jpg)
![Western Blot STAT2 [p Tyr690] Antibody (1021D) [Unconjugated]](https://images.novusbio.com/images2/STAT2_MAB2890_Western_Blot_14700.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_815.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_816.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/TNF_RI_DRT100_ELISA_175.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")