![Western Blot: COMP/Thrombospondin-5 Antibody [NBP2-92658] - Western blot analysis of extracts of various cell lines, using COMP/Thrombospondin-5 antibody (NBP2-92658) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/COMP-Thrombospondin-5-Antibody-Western-Blot-NBP2-92658-img0003.jpg "Western Blot: COMP/Thrombospondin-5 Antibody [NBP2-92658] - Western blot analysis of extracts of various cell lines, using COMP/Thrombospondin-5 antibody (NBP2-92658) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-160 of human COMP (NP_000086.2). GQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | COMP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 83 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for COMP/Thrombospondin-5 Antibody (NBP2-92658)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COMP |
![Immunohistochemistry: COMP/Thrombospondin-5 Antibody [NBP2-92658] - Immunofluorescence analysis of Mouse cartilage using COMP/Thrombospondin-5 Rabbit pAb (NBP2-92658) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/COMP-Thrombospondin-5-Antibody-Immunohistochemistry-NBP2-92658-img0002.jpg "Immunohistochemistry: COMP/Thrombospondin-5 Antibody [NBP2-92658] - Immunofluorescence analysis of Mouse cartilage using COMP/Thrombospondin-5 Rabbit pAb (NBP2-92658) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot: COMP/Thrombospondin-5 Antibody [NBP2-92658] - Western blot analysis of extracts of various cell lines, using COMP/Thrombospondin-5 antibody (NBP2-92658) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/COMP-Thrombospondin-5 Antibody-Western Blot-NBP2-92658-img0004.jpg "Western Blot: COMP/Thrombospondin-5 Antibody [NBP2-92658] - Western blot analysis of extracts of various cell lines, using COMP/Thrombospondin-5 antibody (NBP2-92658) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
![Immunohistochemistry: COMP/Thrombospondin-5 Antibody [NBP2-92658] - Immunofluorescence analysis of Rat cartilage using COMP/Thrombospondin-5 Rabbit pAb (NBP2-92658) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/COMP-Thrombospondin-5-Antibody-Immunohistochemistry-NBP2-92658-img0001.jpg "Immunohistochemistry: COMP/Thrombospondin-5 Antibody [NBP2-92658] - Immunofluorescence analysis of Rat cartilage using COMP/Thrombospondin-5 Rabbit pAb (NBP2-92658) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.")
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A Thrombospondin-1 [HRP]](https://images.novusbio.com/images2/Thrombospondin-1_DTSP10_ELISA_199.jpg)
![N/A MMP-3 [HRP]](https://images.novusbio.com/images2/DATA_MMP3_DMP300_ELISA_767.jpg)
![N/A MMP-3 [HRP]](https://images.novusbio.com/images2/MMP-3_DMP300_ELISA_145.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Bioactivity IBSP/Sialoprotein II [Unconjugated]](https://images.novusbio.com/images/4014-sp_recombinant-human-ibsp-sialoprotein-ii-protein-cf-bioactivity-4420249391..jpg)
![Immunocytochemistry SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Immunocytochemistry_15995.jpg)
![Western Blot SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Western_Blot_21580.jpg)
![Immunocytochemistry SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Immunocytochemistry_6490.jpg)
![Western Blot Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Western_Blot_17244.jpg)
![Simple Western Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Simple_Western_17469.jpg)
![Immunohistochemistry Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Immunohistochemistry_17623.jpg)
![N/A Chitinase 3-like 1/YKL-40 [HRP]](https://images.novusbio.com/images2/Chitinase_3-like_1_DC3L10_ELISA_45.jpg)
![N/A Chitinase 3-like 1/YKL-40 [HRP]](https://images.novusbio.com/images2/DATA_Chitinase_3like_1_DC3L10_ELISA_601.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")