Reactivity | Hu, RtSpecies Glossary |
Applications | IHC, CyTOF-ready, Flow, ICC/IF |
Clone | 190125 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Concentration | LYOPH |
Immunogen | Human Osteocalcin synthetic peptide YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Accession # P02818 |
Specificity | Detects human Osteocalcin in direct ELISAs. |
Source | N/A |
Isotype | IgG1 |
Clonality | Monoclonal |
Host | Mouse |
Gene | BGLAP |
Purity | Protein A or G purified from hybridoma culture supernatant |
Purity Statement | Protein A or G purified from hybridoma culture supernatant |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Reviewed Applications |
|
|
Publications |
|
Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
|
Buffer | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 µm filtered solution in PBS. |
Preservative | No Preservative |
Concentration | LYOPH |
Purity | Protein A or G purified from hybridoma culture supernatant |
Reconstitution Instructions | Reconstitute at 0.5 mg/mL in sterile PBS. |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
reviewed by:
Verified Customer |
ICC | Human | 02/09/2022 |
Summary
Comments
|
|||||||||||
reviewed by:
Verified Customer |
ICC | Rat | 02/10/2015 |
Summary
|
|||||||||||
reviewed by:
Verified Customer |
Flow | Human | 02/10/2015 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Verified Customer 02/09/2022 |
||
Application: | ICC | |
Species: | Human |
Verified Customer 02/10/2015 |
||
Application: | ICC | |
Species: | Rat |
Verified Customer 02/10/2015 |
||
Application: | Flow | |
Species: | Human |