Name: Osteocalcin Antibody (190125)
Brand: Novus Biologicals
SKU: MAB1419
Rating: 4.3 (3 reviews)

- COVID-19 Research Tools
  
  Antibodies
  Primary Antibodies
  Conjugated Antibodies
  
  Sample Size Antibodies
  
  KO Validated Antibodies
  
  Recombinant Antibodies
  
  Antibody Sampler Packs
  
  Antibody Pairs
  
  Secondary Antibodies
  
  Isotype Control Antibodies
  
  Proteins and Peptides
  Peptides & Proteins
  
  Blocking Peptides
  
  Biologically Active Proteins
  
  Lysates and Cell Lines
  Lysates
  
  Stem Cell Lines
- Kits
  Antibody Labeling Kits
  
  ChIP Kits
  
  ELISA Kits
  
  Flow Cytometry Kits
  
  Activators and Inhibitors
  Inhibitors
  
  Activators
  
  Support Products
  Exosome Isolation
  
  Flow Cytometry Beads
  
  IHC Tissue Slides
  
  IHC Microarrays
  
  Western Blot Gels & Buffers
  
  Western Blot Membranes
  
  All Support Products
  
  Bulk and Custom
Products
Our Protocols
- Resources
  Protocols
  
  Video Protocols
  
  Troubleshooting Guides
  
  Posters and Literature
  
  Handbooks and Guides
  
  Calculators
  
  FAQs
  
  Blogs
  
  Diseases
  
  Whitepapers
  
  Antibody Concierge
  
  Webinars
- Tools
  Spectra Viewer
  
  Flow Cytometry Panel Builder
  
  Application
  ELISA
  
  Flow Cytometry
  
  Mass Cytometry (CyTOF)
  
  ICC
  
  IHC
  
  Western Blotting
  
  Interviews
  Faculty
  
  Postdoc
Resources
View Pathways
- By Research Area
  Apoptosis
  
  Autophagy
  
  Cancer
  
  Cell Biology
  
  Cellular Markers
  
  Epigenetics
  
  Epitope Tags
  
  Exosomes Research
  
  Hypoxia
  
  Immunology
  
  Microbiology
  
  Neuroscience
  
  Stem Cells
- By Pathway
  AKT
  
  Apoptosis
  
  Autophagy
  
  ERK1/2/5 Pathway
  
  Hedgehog
  
  Hippo
  
  JNK Pathway
  
  mTOR
  
  Necroptosis
  
  NFKB Signaling
  
  p38 Signaling
  
  TGF Beta
  
  TLR
Research Areas
Get Rewards
- Customer Care
  100% Guarantee
  
  Risk Free Testing
  
  Novus Rewards Program
  
  Publication Rewards Program
  
  New Lab Discount
  
  Scholarship
  
  Travel Grants
  
  Promotions
Customer Care
Novus Careers
- About us
  Careers
  
  Collaborations
  
  Events
  
  Novus Story
  
  Our Team
  
  Philanthropy
  
  Press Releases
  
  Why choose Novus
About Us
- Contact Us
  Customer Service
  
  Distributors
  
  Technical Support
Contact

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, RtSpecies Glossary
Applications	IHC, CyTOF-ready, Flow, ICC/IF
Clone	190125
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated
Concentration	LYOPH

Catalog# & Conjugate	Size	Price
Alexa Fluor 350 FAB1419U

Alexa Fluor 350 IC1419U-100UG

Alexa Fluor 405 IC1419V-100UG

Alexa Fluor 405 FAB1419V

Alexa Fluor 488 FAB1419G

Alexa Fluor 488 IC1419G

Alexa Fluor 532 FAB1419X

Alexa Fluor 594 IC1419T-100UG

Alexa Fluor 594 FAB1419T

Alexa Fluor 647 IC1419R-100UG

Alexa Fluor 647 FAB1419R

Alexa Fluor 700 FAB1419N

Alexa Fluor 700 IC1419N-100UG

Alexa Fluor 750 FAB1419S

Alexa Fluor 750 IC1419S-100UG

Allophycocyanin IC1419A

Allophycocyanin FAB1419A

Biotin FAB1419B

DyLight 350 FAB1419D

DyLight 405 FAB1419E

DyLight 488 FAB1419K

DyLight 550 FAB1419L

DyLight 594 FAB1419M

DyLight 650 FAB1419W

DyLight 680 FAB1419Y

DyLight 755 FAB1419Z

FITC FAB1419F

HRP FAB1419H

Janelia Fluor 549 FAB1419I

Janelia Fluor 646 FAB1419J

PE FAB1419P

PerCP FAB1419C

Phycoerythrin IC1419P

mFluor Violet 450 SE FAB1419MFV450

mFluor Violet 500 SE FAB1419MFV500

mFluor Violet 610 SE FAB1419MFV610

Catalog# & Formulation	Size	Price
Carrier Free IC1419P

Carrier Free IC1419A

Carrier Free MAB1419-SP

Carrier Free IC1419G

Carrier Free IC1419T-100UG

Carrier Free IC1419S-100UG

Carrier Free IC1419R-100UG

Carrier Free IC1419N-100UG

Carrier Free IC1419V-100UG

Carrier Free IC1419U-100UG

Conjugate	Catalog #	Availability	Size	Price
Alexa Fluor 350	FAB1419U
Alexa Fluor 350	IC1419U-100UG
Alexa Fluor 405	IC1419V-100UG
Alexa Fluor 405	FAB1419V
Alexa Fluor 488	FAB1419G
Alexa Fluor 488	IC1419G
Alexa Fluor 532	FAB1419X
Alexa Fluor 594	IC1419T-100UG
Alexa Fluor 594	FAB1419T
Alexa Fluor 647	IC1419R-100UG
Alexa Fluor 647	FAB1419R
Alexa Fluor 700	FAB1419N
Alexa Fluor 700	IC1419N-100UG
Alexa Fluor 750	FAB1419S
Alexa Fluor 750	IC1419S-100UG
Allophycocyanin	IC1419A
Allophycocyanin	FAB1419A
Biotin	FAB1419B
DyLight 350	FAB1419D
DyLight 405	FAB1419E
DyLight 488	FAB1419K
DyLight 550	FAB1419L
DyLight 594	FAB1419M
DyLight 650	FAB1419W
DyLight 680	FAB1419Y
DyLight 755	FAB1419Z
FITC	FAB1419F
HRP	FAB1419H
Janelia Fluor 549	FAB1419I
Janelia Fluor 646	FAB1419J
PE	FAB1419P
PerCP	FAB1419C
Phycoerythrin	IC1419P
mFluor Violet 450 SE	FAB1419MFV450
mFluor Violet 500 SE	FAB1419MFV500
mFluor Violet 610 SE	FAB1419MFV610

Osteocalcin Antibody (190125)

Species Glossary

Images

Product Details

Order Details

Osteocalcin Antibody (190125) Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Osteocalcin Antibody (190125)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Osteocalcin Antibody (MAB1419)(54)

Reviews for Osteocalcin Antibody (MAB1419) (3) 4.33

Summary

Comments

Summary

Summary

FAQs for Osteocalcin Antibody (MAB1419) (0)

Secondary Antibodies

Isotype Controls

Additional Osteocalcin Products

Blogs on Osteocalcin

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Recent Reviews

Bioinformatics

Immunogen	Human Osteocalcin synthetic peptide YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Accession # P02818
Specificity	Detects human Osteocalcin in direct ELISAs.
Source	N/A
Isotype	IgG1
Clonality	Monoclonal
Host	Mouse
Gene	BGLAP
Purity	Protein A or G purified from hybridoma culture supernatant
Purity Statement	Protein A or G purified from hybridoma culture supernatant
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Buffer	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 µm filtered solution in PBS.
Preservative	No Preservative
Concentration	LYOPH
Purity	Protein A or G purified from hybridoma culture supernatant
Reconstitution Instructions	Reconstitute at 0.5 mg/mL in sterile PBS.

Publications using MAB1419	Applications	Species
Cárdenas-Aguazaco, W;Camacho, B;Gómez-Pachón, EY;Lara-Bertrand, AL;Silva-Cote, I; Electrospun Scaffolds of Polylactic Acid, Collagen, and Amorphous Calcium Phosphate for Bone Repair Pharmaceutics 2023-10-25 [PMID: 38004509] (IHC, Human)	IHC	Human
Shi Yin, Sihan Lin, Jingyi Xu, Guangzheng Yang, Hongyan Chen, Xinquan Jiang Dominoes with interlocking consequences triggered by zinc: involvement of microelement-stimulated MSC-derived exosomes in senile osteogenesis and osteoclast dialogue J Nanobiotechnology 9/23/2023 [PMID: 37741978]
Umrath, F;Schmitt, LF;Kliesch, SM;Schille, C;Geis-Gerstorfer, J;Gurewitsch, E;Bahrini, K;Peters, F;Reinert, S;Alexander, D; Mechanical and Functional Improvement of ?-TCP Scaffolds for Use in Bone Tissue Engineering Journal of functional biomaterials 2023-08-16 [PMID: 37623671] (Human)		Human
Honorine Dushime, Stéphanie G. Moreno, Christine Linard, Annie Adrait, Yohann Couté, Juliette Peltzer et al. Fetal Muse-based therapy prevents lethal radio-induced gastrointestinal syndrome by intestinal regeneration Stem Cell Research & Therapy 8/11/2023 [PMID: 37568164]
Gomez-Sequeda, N;Mendivil-Perez, M;Jimenez-Del-Rio, M;Lopera, F;Velez-Pardo, C; Cholinergic-like neurons and cerebral spheroids bearing the PSEN1 p.Ile416Thr variant mirror Alzheimer's disease neuropathology Scientific reports 2023-08-08 [PMID: 37553376] (ICC, Human)	ICC	Human
Li Jinteng, Xu Peitao, Yu Wenhui, Ye Guiwen, Ye Feng, Xu Xiaojun et al. BMAL1-TTK-H2Bub1 loop deficiency contributes to impaired BM-MSC-mediated bone formation in senile osteoporosis Molecular Therapy - Nucleic Acids 3/14/2023 [PMID: 36910712]
SK Grissom, SA Semevolos, K Duesterdie Role of cartilage and bone matrix regulation in early equine osteochondrosis Bone Reports, 2023-01-05;18(0):101653. 2023-01-05 [PMID: 36632355] (IHC, Equine)	IHC	Equine
Fiona Verisqa, Jae-Ryung Cha, Linh Nguyen, Hae-Won Kim, Jonathan C. Knowles Digital Light Processing 3D Printing of Gyroid Scaffold with Isosorbide-Based Photopolymer for Bone Tissue Engineering Biomolecules 11/15/2022 [PMID: 36421706]
NT Chan, MS Lee, Y Wang, J Galipeau, WJ Li, W Xu CTR9 drives osteochondral lineage differentiation of human mesenchymal stem cells via epigenetic regulation of BMP-2 signaling Science Advances, 2022-11-16;8(46):eadc9222. 2022-11-16 [PMID: 36383652] (ICC, Human)	ICC	Human
Diez-Escudero A, Carlsson E, Andersson B et al. Trabecular Titanium for Orthopedic Applications: Balancing Antimicrobial with Osteoconductive Properties by Varying Silver Contents ACS Applied Materials & Interfaces 9/21/2022 [PMID: 36069272]
X Zhang, W Jiang, C Xie, X Wu, Q Ren, F Wang, X Shen, Y Hong, H Wu, Y Liao, Y Zhang, R Liang, W Sun, Y Gu, T Zhang, Y Chen, W Wei, S Zhang, W Zou, H Ouyang Msx1+ stem cells recruited by bioactive tissue engineering graft for bone regeneration Nature Communications, 2022-09-05;13(1):5211. 2022-09-05 [PMID: 36064711] (IHC, Rat)	IHC	Rat
Xueqin Gao, Mintai P. Hwang, Nathaniel Wright, Aiping Lu, Joseph J. Ruzbarsky, Matthieu Huard et al. The use of heparin/polycation coacervate sustain release system to compare the bone regenerative potentials of 5 BMPs using a critical sized calvarial bone defect model Biomaterials 9/1/2022 [PMID: 36031459]
M Giner, MA Vázquez-Gá, MJ Miranda, J Bocio-Nuñe, FJ Olmo-Monte, MA Rico, MA Colmenero, MJ Montoya-Ga Circulating Osteogenic Progenitor Cells Enhanced with Teriparatide or Denosumab Treatment Journal of Clinical Medicine, 2022-08-14;11(16):. 2022-08-14 [PMID: 36012987] (Flow Cytometry, Human)	Flow Cytometry	Human
JP Ribeiro, RMA Domingues, PS Babo, LP Nogueira, JE Reseland, RL Reis, M Gomez-Flor, ME Gomes Highly elastic and bioactive bone biomimetic scaffolds based on platelet lysate and biomineralized cellulose nanocrystals Carbohydrate polymers, 2022-05-20;292(0):119638. 2022-05-20 [PMID: 35725198] (IHC, Human)	IHC	Human
B Zhang, M Xiao, X Cheng, Y Bai, H Chen, Q Yu, L Qiu Enamel Matrix Derivative Enhances the Odontoblastic Differentiation of Dental Pulp Stem Cells via Activating MAPK Signaling Pathways Stem Cells International, 2022-04-28;2022(0):2236250. 2022-04-28 [PMID: 35530415] (IHC, Mouse)	IHC	Mouse
NA Luchman, R Megat Abdu, SH Zainal Ari, NS Nasruddin, SF Lau, F Yazid Comparison between hydroxyapatite and polycaprolactone in inducing osteogenic differentiation and augmenting maxillary bone regeneration in rats PeerJ, 2022-05-02;10(0):e13356. 2022-05-02 [PMID: 35529494] (IHC, Rat)	IHC	Rat
Zhong Li, Zixuan Lin, Silvia Liu, Haruyo Yagi, Xiurui Zhang, Lauren Yocum et al. Human Mesenchymal Stem Cell‐Derived Miniature Joint System for Disease Modeling and Drug Testing Advanced Science 7/1/2022 [PMID: 35436042]
S Martin-Igl, L Milian, M Sancho-Tel, R Salvador-C, JJ Martín de, C Carda, M Mata BMP-2 Enhances Osteogenic Differentiation of Human Adipose-Derived and Dental Pulp Stem Cells in 2D and 3D In Vitro Models Stem Cells International, 2022-03-04;2022(0):4910399. 2022-03-04 [PMID: 35283997] (ICC, Human)	ICC	Human
Q Heydt, C Xintaropou, A Clear, M Austin, I Pislariu, F Miraki-Mou, P Cutillas, K Korfi, M Calaminici, W Cawthorn, K Suchacki, A Nagano, JG Gribben, M Smith, JD Cavenagh, H Oakervee, A Castleton, D Taussig, B Peck, A Wilczynska, L McNaughton, D Bonnet, F Mardakheh, B Patel Adipocytes disrupt the translational programme of acute lymphoblastic leukaemia to favour tumour survival and persistence Nature Communications, 2021-09-17;12(1):5507. 2021-09-17 [PMID: 34535653] (ICC/IF, Human)	ICC/IF	Human
L E, R Lu, J Sun, H Li, W Xu, H Xing, X Wang, T Cheng, S Zhang, X Ma, R Zhang, H Liu Microenvironment Influences on Human Umbilical Cord Mesenchymal Stem Cell-Based Bone Regeneration Stem Cells International, 2021-08-17;2021(0):4465022. 2021-08-17 [PMID: 34447439] (ICC, Human)	ICC	Human
Acharya TK, Kumar S, Tiwari N et al. TRPM8 channel inhibitor-encapsulated hydrogel as a tunable surface for bone tissue engineering Scientific reports 2/12/2021 [PMID: 33580126]
S Lv, J Xu, L Chen, H Wu, W Feng, Y Zheng, P Li, H Zhang, L Zhang, G Chi, Y Li MicroRNA-27b targets CBFB to inhibit differentiation of human bone marrow mesenchymal stem cells into hypertrophic chondrocytes Stem Cell Res Ther, 2020-09-11;11(1):392. 2020-09-11 [PMID: 32917285] (IHC, Rat)	IHC	Rat
C Liang, Z Liu, M Song, W Li, Z Wu, Z Wang, Q Wang, S Wang, K Yan, L Sun, T Hishida, Y Cai, JCI Belmonte, P Guillen, P Chan, Q Zhou, W Zhang, J Qu, GH Liu Stabilization of heterochromatin by CLOCK promotes stem cell rejuvenation and cartilage regeneration Cell Res., 2020-07-31;0(0):. 2020-07-31 [PMID: 32737416] (ICC, Human)	ICC	Human
Qiushi Wei, Bin Wang, Hailan Hu, Chuhai Xie, Long Ling, Jianliang Gao et al. Icaritin promotes the osteogenesis of bone marrow mesenchymal stem cells via the regulation of sclerostin expression International Journal of Molecular Medicine 1/20/2020 [PMID: 31985018]
J Chen, C Tu, X Tang, H Li, J Yan, Y Ma, H Wu, C Liu The combinatory effect of sinusoidal electromagnetic field and VEGF promotes osteogenesis and angiogenesis of mesenchymal stem cell-laden PCL/HA implants in a rat subcritical cranial defect Stem Cell Res Ther, 2019-12-16;10(1):379. 2019-12-16 [PMID: 31842985] (ICC, Rat)	ICC	Rat
V Miceli, M Pampalone, S Vella, AP Carreca, G Amico, PG Conaldi Comparison of Immunosuppressive and Angiogenic Properties of Human Amnion-Derived Mesenchymal Stem Cells between 2D and 3D Culture Systems Stem Cells Int, 2019-02-18;2019(0):7486279. 2019-02-18 [PMID: 30911299] (ICC, Human)	ICC	Human
Claudia Loebel, Robert L. Mauck, Jason A. Burdick Local nascent protein deposition and remodelling guide mesenchymal stromal cell mechanosensing and fate in three-dimensional hydrogels Nature Materials 8/1/2019 [PMID: 30886401]
AD Kolb, AB Shupp, D Mukhopadhy, FC Marini, KM Bussard Osteoblasts are "educated" by crosstalk with metastatic breast cancer cells in the bone tumor microenvironment Breast Cancer Res., 2019-02-27;21(1):31. 2019-02-27 [PMID: 30813947] (ICC, IHC-P, Human)	ICC, IHC-P	Human
A Kapelouzou, C Kontogiann, DI Tsilimigra, G Georgiopou, L Kaklamanis, L Tsourelis, DV Cokkinos Differential expression patterns of Toll Like Receptors and Interleukin-37 between calcific aortic and mitral valve cusps in humans Cytokine, 2019-02-01;116(0):150-160. 2019-02-01 [PMID: 30716659] (IHC, Human)	IHC	Human
X Gao, A Lu, Y Tang, J Schneppend, AB Liebowitz, AC Scibetta, ER Morris, H Cheng, C Huard, S Amra, B Wang, MA Hall, WR Lowe, J Huard Influences of donor and host age on human muscle-derived stem cell-mediated bone regeneration Stem Cell Res Ther, 2018-11-21;9(1):316. 2018-11-21 [PMID: 30463597] (IHC-Fr, Human)	IHC-Fr	Human
Maryam Eyvazi, Raheleh Farahzadi, Nahid Karimian Fathi, Mohammad Karimipour, Jafar Soleimani Rad, Azadeh Montaseri Mummy Material Can Promote Differentiation of Adipose Derived Stem Cells into Osteoblast through Enhancement of Bone Specific Transcription Factors Expression Advanced Pharmaceutical Bulletin 8/29/2018 [PMID: 30276142]
Y Zhu, Y Wu, J Cheng, Q Wang, Z Li, Y Wang, D Wang, H Wang, W Zhang, J Ye, H Jiang, L Wang Pharmacological activation of TAZ enhances osteogenic differentiation and bone formation of adipose-derived stem cells Stem Cell Res Ther, 2018-03-07;9(1):53. 2018-03-07 [PMID: 29514703] (IHC, Human)	IHC	Human
MH Amer, FRAJ Rose, KM Shakesheff, LJ White A biomaterials approach to influence stem cell fate in injectable cell-based therapies Stem Cell Res Ther, 2018-02-21;9(1):39. 2018-02-21 [PMID: 29467014] (ICC, Human)	ICC	Human
C Arianna, C Eliana, A Flavio, R Marco, D Giacomo, S Manuel, B Elena, G Alessandra Rapid Rapamycin-Only Induced Osteogenic Differentiation of Blood-Derived Stem Cells and Their Adhesion to Natural and Artificial Scaffolds Stem Cells Int, 2017-07-26;2017(0):2976541. 2017-07-26 [PMID: 28814956] (ICC, Human)	ICC	Human
G Lisignoli, E Lambertini, C Manferdini, E Gabusi, L Penolazzi, F Paolella, M Angelozzi, V Casagranda, R Piva Collagen type XV and the 'osteogenic status' J. Cell. Mol. Med, 2017-03-22;0(0):. 2017-03-22 [PMID: 28332281] (Flow Cytometry, Human)	Flow Cytometry	Human
K Tatebayash, Y Tanaka, A Nakano-Doi, R Sakuma, S Kamachi, M Shirakawa, K Uchida, H Kageyama, T Takagi, S Yoshimura, T Matsuyama, T Nakagomi Identification of multipotent stem cells in human brain tissue following stroke Stem Cells Dev, 2017-04-19;0(0):. 2017-04-19 [PMID: 28323540] (ICC, Human)	ICC	Human
YR Lou, TC Toh, YH Tee, H Yu 25-Hydroxyvitamin D3 induces osteogenic differentiation of human mesenchymal stem cells Sci Rep, 2017-02-17;7(0):42816. 2017-02-17 [PMID: 28211493] (ICC, Human)	ICC	Human
Transcriptome sequencing wide functional analysis of human mesenchymal stem cells in response to TLR4 ligand Sci Rep, 2016-07-22;6(0):30311. 2016-07-22 [PMID: 27444640] (IHC, Human)	IHC	Human
Immobilized WNT Proteins Act as a Stem Cell Niche for Tissue Engineering Stem Cell Reports, 2016-07-12;7(1):126-37. 2016-07-12 [PMID: 27411105] (IHC, Human)	IHC	Human
N Nasiri, A Ceramidas, S Mukherjee, A Panneersel, DR Nisbet, A Tricoli Ultra-Porous Nanoparticle Networks: A Biomimetic Coating Morphology for Enhanced Cellular Response and Infiltration Sci Rep, 2016-04-14;6(0):24305. 2016-04-14 [PMID: 27076035] (IHC-Fr, Mouse)	IHC-Fr	Mouse
Alkistis Kapelouzou, Loukas Tsourelis, Loukas Kaklamanis, Dimitrios Degiannis, Nektarios Kogerakis, Dennis V. Cokkinos Serum and tissue biomarkers in aortic stenosis Global Cardiology Science and Practice 11/13/2015 [PMID: 26779524]
Qian G, Fan W, Ahlemeyer B, Karnati S, Baumgart-Vogt E Peroxisomes in Different Skeletal Cell Types during Intramembranous and Endochondral Ossification and Their Regulation during Osteoblast Differentiation by Distinct Peroxisome Proliferator-Activated Receptors. PLoS ONE, 2015-12-02;10(12):e0143439. 12/2/2015 [PMID: 26630504]
Zhu W, Zhang Q, Zhang Y, Cen L, Wang J PDL regeneration via cell homing in delayed replantation of avulsed teeth. J Transl Med, 2015-11-14;13(0):357. 2015-11-14 [PMID: 26572489] (IHC-P, Canine)	IHC-P	Canine
A Carpentieri, E Cozzoli, M Scimeca, E Bonanno, A M Sardanelli, A Gambacurta Differentiation of human neuroblastoma cells toward the osteogenic lineage by mTOR inhibitor Cell Death & Disease 11/12/2015 [PMID: 26561783]
Raphael Yao, Joyce Y. Wong The Effects of Mechanical Stimulation on Controlling and Maintaining Marrow Stromal Cell Differentiation Into Vascular Smooth Muscle Cells Journal of Biomechanical Engineering 2/1/2015 [PMID: 25429403]
Pereira R, Delany A, Khouzam N, Bowen R, Freymiller E, Salusky I, Wesseling-Perry K Primary osteoblast-like cells from patients with end-stage kidney disease reflect gene expression, proliferation, and mineralization characteristics ex vivo. Kidney Int, 2014-10-29;87(3):593-601. 2014-10-29 [PMID: 25354236] (IHC, Human)	IHC	Human
Marfia G, Navone S, Di Vito C, Tabano S, Giammattei L, Di Cristofori A, Gualtierotti R, Tremolada C, Zavanone M, Caroli M, Torchia F, Miozzo M, Rampini P, Riboni L, Campanella R Gene expression profile analysis of human mesenchymal stem cells from herniated and degenerated intervertebral discs reveals different expression of osteopontin. Stem Cells Dev, 2014-10-29;24(3):320-8. 2014-10-29 [PMID: 25203751] (ICC, Human)	ICC	Human
Xia H, Bodempudi V, Benyumov A, Hergert P, Tank D, Herrera J, Braziunas J, Larsson O, Parker M, Rossi D, Smith K, Peterson M, Limper A, Jessurun J, Connett J, Ingbar D, Phan S, Bitterman P, Henke C Identification of a cell-of-origin for fibroblasts comprising the fibrotic reticulum in idiopathic pulmonary fibrosis. Am J Pathol, 2014-03-13;184(5):1369-83. 2014-03-13 [PMID: 24631025] (IHC, Human)	IHC	Human
Govindarajan P, Bocker W, El Khassawna T, Kampschulte M, Schlewitz G, Huerter B, Sommer U, Durselen L, Ignatius A, Bauer N, Szalay G, Wenisch S, Lips K, Schnettler R, Langheinrich A, Heiss C Bone matrix, cellularity, and structural changes in a rat model with high-turnover osteoporosis induced by combined ovariectomy and a multiple-deficient diet. Am J Pathol, 2013-12-31;184(3):765-77. 2013-12-31 [PMID: 24384131] (IHC, Rat)	IHC	Rat
Reinhardt P, Glatza M, Hemmer K, Tsytsyura Y, Thiel C, Hoing S, Moritz S, Parga J, Wagner L, Bruder J, Wu G, Schmid B, Ropke A, Klingauf J, Schwamborn J, Gasser T, Scholer H, Sterneckert J Derivation and expansion using only small molecules of human neural progenitors for neurodegenerative disease modeling. PLoS ONE, 2013-03-22;8(3):e59252. 2013-03-22 [PMID: 23533608] (ICC, Human)	ICC	Human
Poundarik , Atharva, Diab , Tamim, Sroga , Grazyna, Ural , Ani, Boskey , Adele L, Gundberg , Caren M, Vashishth , Deepak Dilatational band formation in bone. Proc Natl Acad Sci U S A, 2012-11-05;109(47):19178-83. 2012-11-05 [PMID: 23129653] (IHC, Human)	IHC	Human
Asumda FZ, Chase PB Age-related changes in rat bone-marrow mesenchymal stem cell plasticity. BMC Cell Biol., 2011-10-12;12(0):44. 2011-10-12 [PMID: 21992089] (ICC, Rat)	ICC	Rat
Curran JM, Chen R, Hunt JA The guidance of human mesenchymal stem cell differentiation in vitro by controlled modifications to the cell substrate. Biomaterials, 2006-06-02;27(27):4783-93. 2006-06-02 [PMID: 16735063] (ICC, Human)	ICC	Human
Krout A, Wen HB, Hippensteel E, Li P A hybrid coating of biomimetic apatite and osteocalcin. J Biomed Mater Res A, 2005-06-15;73(4):377-87. 2005-06-15 [PMID: 15957205] (IHC, Rat)	IHC	Rat
Show All 54 Publications. Collapse Publications.

	Verified Customer 02/09/2022
Application:	ICC
Species:	Human

	Verified Customer 02/10/2015
Application:	ICC
Species:	Rat

	Verified Customer 02/10/2015
Application:	Flow
Species:	Human

Gene Symbol	BGLAP
Uniprot	P02818()