![Immunohistochemistry-Paraffin: Bcl-9 Antibody [NBP2-30472] - Analysis in human fallopian tube and pancreas tissues. Corresponding BCL9 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Bcl-9-Antibody-Immunohistochemistry-Paraffin-NBP2-30472-img0007.jpg "Immunohistochemistry-Paraffin: Bcl-9 Antibody [NBP2-30472] - Analysis in human fallopian tube and pancreas tissues. Corresponding BCL9 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FTGAQSGGPQQNPGVLDGPQKKPEGPIQAMMAQSQSLGKGPGPRTDVGAPFGPQGHRDVPFSPDEMVPPSMNSQSGTIGPDHLDHMTPEQIAWLKLQQEFYEEKRRKQEQVVVQQCSLQD |
| Predicted Species | Mouse (93%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BCL9 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
![Immunocytochemistry Pygopus-2 Antibody (539730) [Unconjugated]](https://images.novusbio.com/images2/Pygopus-2_MAB3616_Immunocytochemistry_10465.jpg)
![Western Blot Pygopus-2 Antibody (539730) [Unconjugated]](https://images.novusbio.com/images2/Pygopus-2_MAB3616_Western_Blot_10485.jpg)
![Simple Western Pygopus-2 Antibody (539730) [Unconjugated]](https://images.novusbio.com/images2/Pygopus2_MAB3616_Simple_Western_16406.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Bcl-9 Antibody (NBP2-30472)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Bcl-9 Antibody [NBP2-30472] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm & nuclear bodies. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Bcl-9-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30472-img0003.jpg "Immunocytochemistry/Immunofluorescence: Bcl-9 Antibody [NBP2-30472] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm & nuclear bodies. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Bcl-9 Antibody [NBP2-30472] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Bcl-9-Antibody-Immunohistochemistry-Paraffin-NBP2-30472-img0011.jpg "Immunohistochemistry-Paraffin: Bcl-9 Antibody [NBP2-30472] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: Bcl-9 Antibody [NBP2-30472] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/Bcl-9-Antibody-Immunohistochemistry-Paraffin-NBP2-30472-img0008.jpg "Immunohistochemistry-Paraffin: Bcl-9 Antibody [NBP2-30472] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Bcl-9 Antibody [NBP2-30472] - Staining of human kidney shows weak nuclear positivity in cells in tubules.](http://images.novusbio.com/fullsize/Bcl-9-Antibody-Immunohistochemistry-Paraffin-NBP2-30472-img0009.jpg "Immunohistochemistry-Paraffin: Bcl-9 Antibody [NBP2-30472] - Staining of human kidney shows weak nuclear positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Bcl-9 Antibody [NBP2-30472] - Staining of human pancreas shows strong nuclear positivity in Langerhans cells, exocrine pancreas was negative as expected](http://images.novusbio.com/fullsize/Bcl-9-Antibody-Immunohistochemistry-Paraffin-NBP2-30472-img0010.jpg "Immunohistochemistry-Paraffin: Bcl-9 Antibody [NBP2-30472] - Staining of human pancreas shows strong nuclear positivity in Langerhans cells, exocrine pancreas was negative as expected")
![Western Blot BCL9-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Bcl9-2_AF4967_Western_Blot_5591.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/PlGF_DPG00_ELISA_158.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_788.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_789.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")