![Western Blot: TCF7L2 Antibody (3A4) [H00006934-M06] - Analysis of TCF7L2 expression in K-562 (Cat # L009V1).](http://images.novusbio.com/fullsize/TCF7L2-Antibody-3A4-Western-Blot-H00006934-M06-img0007.jpg "Western Blot: TCF7L2 Antibody (3A4) [H00006934-M06] - Analysis of TCF7L2 expression in K-562 (Cat # L009V1).")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 3A4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | TCF7L2 (NP_110383, 490 a.a. ~ 596 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE |
| Specificity | TCF7L2 (3A4) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TCF7L2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.Use in Immunohistochemistry reported in scientific literature (PMID: 22796301). |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
![Immunohistochemistry ZnT-8/SLC30A8 Antibody (815039) [Unconjugated]](https://images.novusbio.com/images2/ZnT8_MAB7936_Immunohistochemistry_12988.jpg)
![Intracellular Staining by Flow Cytometry ZnT-8/SLC30A8 Antibody (815039) [Unconjugated]](https://images.novusbio.com/images2/ZnT8_MAB7936_Flow_Cytometry_23901.jpg)
| Publication using H00006934-M06 | Applications | Species |
|---|---|---|
| Weaver C, Turner N, Hall J. Review of the neuroanatomic landscape implicated in glucose sensing and regulation of nutrient signaling: Immunophenotypic localization of diabetes gene Tcf7l2 in the developing murine brain J Chem Neuroanat 2012-07-12 [PMID: 22796301] (IF/IHC, ICC/IF, Mouse) | IF/IHC, ICC/IF | Mouse |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Sarah Daud |
WB | Human | 08/22/2012 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for TCF7L2 Antibody (H00006934-M06)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: TCF7L2 Antibody (3A4) [H00006934-M06] - Analysis of monoclonal antibody to TCF7L2 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/TCF7L2-Antibody-3A4-Immunocytochemistry-Immunofluorescence-H00006934-M06-img0005.jpg "Immunocytochemistry/Immunofluorescence: TCF7L2 Antibody (3A4) [H00006934-M06] - Analysis of monoclonal antibody to TCF7L2 on HeLa cell. Antibody concentration 10 ug/ml")
![Immunohistochemistry-Paraffin: TCF7L2 Antibody (3A4) [H00006934-M06] - Analysis of monoclonal antibody to TCF7L2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml](http://images.novusbio.com/fullsize/TCF7L2-Antibody-3A4-Immunohistochemistry-Paraffin-H00006934-M06-img0006.jpg "Immunohistochemistry-Paraffin: TCF7L2 Antibody (3A4) [H00006934-M06] - Analysis of monoclonal antibody to TCF7L2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml")
![ELISA: TCF7L2 Antibody (3A4) [H00006934-M06] - Detection limit for recombinant GST tagged TCF7L2 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/TCF7L2-Antibody-3A4-ELISA-H00006934-M06-img0004.jpg "ELISA: TCF7L2 Antibody (3A4) [H00006934-M06] - Detection limit for recombinant GST tagged TCF7L2 is approximately 0.03ng/ml as a capture antibody.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot TCF7/TCF1 Antibody (812145) [Unconjugated]](https://images.novusbio.com/images2/TCF7_MAB8224_Western_Blot_14720.jpg)
![Intracellular Staining by Flow Cytometry TCF7/TCF1 Antibody (812145) [Unconjugated]](https://images.novusbio.com/images2/TCF7_MAB8224_Flow_Cytometry_14888.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")
