![Immunocytochemistry/Immunofluorescence: Plectin Antibody [NBP1-84020] - Plectin antibody in indirect immunofluorescence staining of human tumor cells using a green-fluorescent secondary antibody. Nuclei stained with DAPI (blue). Image from verified customer review.](http://images.novusbio.com/fullsize/Plectin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84020-img0017.jpg "Immunocytochemistry/Immunofluorescence: Plectin Antibody [NBP1-84020] - Plectin antibody in indirect immunofluorescence staining of human tumor cells using a green-fluorescent secondary antibody. Nuclei stained with DAPI (blue). Image from verified customer review.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LTGLSLLPLSEKAARARQEELYSELQARETFEKTPVEVPVGGFKGRTVTVWELISSEYFTAEQRQELLRQFRTGKVTVEKVIKILIT |
| Predicted Species | Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLEC |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Felix Oppel |
Indirect Immunofluorescence | Human | 05/03/2022 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Felix Oppel 05/03/2022 |
||
| Application: | Indirect Immunofluorescence | |
| Species: | Human |
| Gene Symbol | PLEC |
![Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Plectin-Antibody-Immunohistochemistry-Paraffin-NBP1-84020-img0016.jpg "Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunocytochemistry/Immunofluorescence: Plectin Antibody [NBP1-84020] - Staining of human cell line U-2 OS shows localization to cytosol & intermediate filaments. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Plectin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84020-img0006.jpg "Immunocytochemistry/Immunofluorescence: Plectin Antibody [NBP1-84020] - Staining of human cell line U-2 OS shows localization to cytosol & intermediate filaments. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/Plectin-Antibody-Immunohistochemistry-Paraffin-NBP1-84020-img0007.jpg "Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human skeletal muscle shows high expression.](http://images.novusbio.com/fullsize/Plectin-Antibody-Immunohistochemistry-Paraffin-NBP1-84020-img0008.jpg "Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human skeletal muscle shows high expression.")
![Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining in human skeletal muscle and pancreas tissues using anti-PLEC antibody. Corresponding PLEC RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Plectin-Antibody-Immunohistochemistry-Paraffin-NBP1-84020-img0009.jpg "Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining in human skeletal muscle and pancreas tissues using anti-PLEC antibody. Corresponding PLEC RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human testis.](http://images.novusbio.com/fullsize/Plectin-Antibody-Immunohistochemistry-Paraffin-NBP1-84020-img0011.jpg "Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human testis.")
![Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human liver.](http://images.novusbio.com/fullsize/Plectin-Antibody-Immunohistochemistry-Paraffin-NBP1-84020-img0012.jpg "Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human liver.")
![Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Analysis in human skeletal muscle and liver tissues. Corresponding Plectin RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Plectin-Antibody-Immunohistochemistry-Paraffin-NBP1-84020-img0013.jpg "Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Analysis in human skeletal muscle and liver tissues. Corresponding Plectin RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human kidney, liver, placenta and skeletal muscle using Anti-Plectin antibody NBP1-84020 (A) shows similar protein distribution across tissues to independent antibody NBP1-84019 (B).](http://images.novusbio.com/fullsize/Plectin-Antibody-Immunohistochemistry-Paraffin-NBP1-84020-img0014.jpg "Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human kidney, liver, placenta and skeletal muscle using Anti-Plectin antibody NBP1-84020 (A) shows similar protein distribution across tissues to independent antibody NBP1-84019 (B).")
![Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.](http://images.novusbio.com/fullsize/Plectin-Antibody-Immunohistochemistry-Paraffin-NBP1-84020-img0015.jpg "Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.")
![PXR/NR1I2 Antibody (H4417) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PXR/NR1I2 Antibody (H4417) [Unconjugated]")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
