![Western Blot: USP9x Antibody (1C4) [H00008239-M01] - USP9x in mouse ovarian cancer cell lysate using anti-USP9x antibody. The primary antibody was used at a dilution of 1:500 and incubated for overnight at 4C in 5% milk with PBST. Image from verified customer review.](http://images.novusbio.com/fullsize/USP9x-Antibody-1C4-Western-Blot-H00008239-M01-img0004.jpg "Western Blot: USP9x Antibody (1C4) [H00008239-M01] - USP9x in mouse ovarian cancer cell lysate using anti-USP9x antibody. The primary antibody was used at a dilution of 1:500 and incubated for overnight at 4C in 5% milk with PBST. Image from verified customer review.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, IP |
| Clone | 1C4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | USP9X (NP_068706, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLP |
| Specificity | USP9X - ubiquitin specific peptidase 9, X-linked (fat facets-like, Drosophila) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | USP9X |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. Use in Immunohistochemistry-paraffin reported in scientific literature (PMID: 20023629). |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Mouse | 12/05/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for USP9x Antibody (H00008239-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: USP9x Antibody (1C4) [H00008239-M01] - Analysis of monoclonal antibody to USP9X on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/USP9x-Antibody-1C4-Immunocytochemistry-Immunofluorescence-H00008239-M01-img0006.jpg "Immunocytochemistry/Immunofluorescence: USP9x Antibody (1C4) [H00008239-M01] - Analysis of monoclonal antibody to USP9X on HeLa cell. Antibody concentration 10 ug/ml.")
![Western Blot: USP9x Antibody (1C4) [H00008239-M01] - USP9X expression in Hela NE ( Cat # L013V3 ).](http://images.novusbio.com/fullsize/USP9x-Antibody-1C4-Western-Blot-H00008239-M01-img0001.jpg "Western Blot: USP9x Antibody (1C4) [H00008239-M01] - USP9X expression in Hela NE ( Cat # L013V3 ).")
![ELISA: USP9x Antibody (1C4) [H00008239-M01] - Detection limit for recombinant GST tagged USP9X is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/USP9x-Antibody-1C4-ELISA-H00008239-M01-img0008.jpg "ELISA: USP9x Antibody (1C4) [H00008239-M01] - Detection limit for recombinant GST tagged USP9X is approximately 0.1ng/ml as a capture antibody.")
![Immunohistochemistry NOV/CCN3 Antibody [Unconjugated]](https://images.novusbio.com/images2/NOV_AF1640_Immunohistochemistry_7314.jpg)
![Immunohistochemistry Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Immunohistochemistry_10417.jpg)
![Immunocytochemistry Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Immunocytochemistry_11095.jpg)
![Western Blot Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Western_Blot_9601.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")
