![Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human cerebral cortex, epididymis, liver and testis using Anti-TOLLIP antibody NBP1-81597 (A) shows similar protein distribution across tissues to independent antibody NBP1-81596 (B).](http://images.novusbio.com/fullsize/Tollip-Antibody-Immunohistochemistry-Paraffin-NBP1-81597-img0011.jpg "Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human cerebral cortex, epididymis, liver and testis using Anti-TOLLIP antibody NBP1-81597 (A) shows similar protein distribution across tissues to independent antibody NBP1-81596 (B).")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TOLLIP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Tollip Antibody (NBP1-81597)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TOLLIP |
![Western Blot: Tollip Antibody [NBP1-81597] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/Tollip-Antibody-Western-Blot-NBP1-81597-img0016.jpg "Western Blot: Tollip Antibody [NBP1-81597] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
![Immunocytochemistry/Immunofluorescence: Tollip Antibody [NBP1-81597] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.](http://images.novusbio.com/fullsize/Tollip-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81597-img0008.jpg "Immunocytochemistry/Immunofluorescence: Tollip Antibody [NBP1-81597] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.")
![Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/Tollip-Antibody-Immunohistochemistry-Paraffin-NBP1-81597-img0015.jpg "Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human cerebral cortex.")
![Western Blot: Tollip Antibody [NBP1-81597] - Analysis in human cerebral cortex tissue.](http://images.novusbio.com/fullsize/Tollip-Antibody-Western-Blot-NBP1-81597-img0009.jpg "Western Blot: Tollip Antibody [NBP1-81597] - Analysis in human cerebral cortex tissue.")
![Western Blot: Tollip Antibody [NBP1-81597] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Tollip-Antibody-Western-Blot-NBP1-81597-img0010.jpg "Western Blot: Tollip Antibody [NBP1-81597] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human liver.](http://images.novusbio.com/fullsize/Tollip-Antibody-Immunohistochemistry-Paraffin-NBP1-81597-img0012.jpg "Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human liver.")
![Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human testis.](http://images.novusbio.com/fullsize/Tollip-Antibody-Immunohistochemistry-Paraffin-NBP1-81597-img0013.jpg "Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human testis.")
![Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human epididymis.](http://images.novusbio.com/fullsize/Tollip-Antibody-Immunohistochemistry-Paraffin-NBP1-81597-img0014.jpg "Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human epididymis.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_304.jpg)
![Bioactivity IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_306.jpg)
![SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images/201-lb_recombinant-human-il-1-beta-il-1f2-protein-sec-mals-123202491556.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Simple Western p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/16324.jpg)
![Western Blot p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Western_Blot_22371.jpg)
![Immunohistochemistry p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Immunohistochemistry_7087.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")