What is the advantage of NBP2-26245 over NBP2-29331? Both of them are TIRAP Inhibitory Peptides but I do not see in the literature provided in the webepage why I would choose one over the other? Or why would I spend more on NBP2-26245?

Name: TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Brand: Novus Biologicals
SKU: NBP2-26245
Price: 559 USD

Question

What is the advantage of NBP2-26245 over NBP2-29331?  Both of them are TIRAP Inhibitory Peptides but I do not see in the literature provided in the webepage why I would choose one over the other? Or why would I spend more on NBP2-26245?

Accepted Answer

While both of these peptides serve the same function, there are differences in the functional sequence. I would like to direct you to to two attached articles in regards to this.  1. NBP2-26245 (Piao, 2013), sequence is shown in Figure 3G, labelled as mTIRAP 2. NBP2-29331: (Shilling 2002), sequence is described under Reagents and Abs on page 5875.  All things aside, we have extensive testing data for NBP2-26245 from in-house testing, whereas we are still in the process of validating NBP2-29331 in-house. We can offer much better support for NBP2-26245 so this is the product I would recommend.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, MuSpecies Glossary
Applications	Flow, Func

Description	TLR2 / TLR4 Inhibitor Peptide: 1 mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML); Molecular weight: 4097.92 Da Antennapedia Control Peptide: 1 mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da
Specificity	TLR2 and TLR4 Inhibitor Peptide: COBRA TLR2 and TLR4 Inhibitor interferes with interaction between TIRAP/Mal and TIR domain of TLR2 or TLR4.
Preparation Method	Preparation of 2.5 mM peptide stock solutions TLR2 / TLR4 Inhibitor Peptide: A final volume of 100 ul will make a 2.5 mM stock solution. Add 100 ul sterile water to the tube of peptide. Carefully pipet to ensure all of the peptide is dissolved and briefly spin the tube before opening. Antennapedia Control Peptide: A final volume of 170 ul will make a 2.5 mM stock solution. Add 170 ul sterile water to the tube of peptide. Carefully pipet to ensure all of the peptide is dissolved and briefly spin the tube before opening. The stock solutions may be diluted further to make working solutions. Dilute according to the needs for your assay. For example, dilute 2.5 mM stock solutions 1:10 in sterile 1X PBS or cell culture media to make 250 uM working solutions. Working solution should be made fresh daily and not be stored.
Gene	TIRAP

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	Form: White solid Solubilize the peptides prior to use by preparing 2.5 mM stock solution in sterile water.

Publications using NBP2-26245	Applications	Species
Wang N, Guo W, Liu T et al. Toll-like receptors (TLR2 and TLR4) antagonist mitigates the onset of cerebral small vessel disease through PI3K/Akt/GSK3? pathway in stroke-prone renovascular hypertensive rats Biotechnology & genetic engineering reviews 2023-03-06 [PMID: 36877597]
Lu HT, Lu JW, Lee CH et al. Attenuative Effects of Platelet-Rich Plasma on 30 kDa Fibronectin Fragment-Induced MMP-13 Expression Associated with TLR2 Signaling in Osteoarthritic Chondrocytes and Synovial Fibroblasts Journal of Clinical Medicine 2021-09-29 [PMID: 34640514]
Jing X, Min C, Qi Yun L et al. Toll-like receptor 2/4 inhibitors can reduce preterm birth in mice J Int Med Res 2020-10-01 [PMID: 33100071]
Yamaguchi M, Hirose Y, Takemura M, et al Streptococcus pneumoniae Evades Host Cell Phagocytosis and Limits Host Mortality Through Its Cell Wall Anchoring Protein PfbA. Front Cell Infect Microbiol. 2019-08-20 [PMID: 31482074] (Bacteria) Details: Mice were infected with S. pneumoniae.		Bacteria
Martinez-Mendez D, Rivera-Toledo E, Ortega E et al. Monocyte-lymphocyte fusion induced by the HIV-1 envelope generates functional heterokaryons with an activated monocyte-like phenotype. Exp. Cell Res. 2017-03-01 [PMID: 28132881]
Cheng Y, Xiong J, Chen Q et al. Hypoxia/reoxygenation-induced HMGB1 translocation and release promotes islet proinflammatory cytokine production and early islet graft failure through TLRs signaling. Biochim. Biophys. Acta. 2016-11-10 [PMID: 27838489] (FLOW, Mouse)	FLOW	Mouse
Pahwa R, Nallasamy P, Jialal I. Toll-like receptors 2 and 4 mediate Hyperglycemia induced Macrovascular Aortic Endothelial Cell Inflammation and Perturbation of the Endothelial Glycocalyx. J Diabetes Complications. 2016-01-22 [PMID: 26908090] (In vitro, Human)	In vitro	Human
Couture LA, Piao W, Ru LW et al. Targeting Toll-like receptor (TLR) signaling by Toll/interleukin-1 receptor (TIR) domain-containing adapter protein/MyD88 adapter-like (TIRAP/Mal)-derived decoy peptides. J Biol Chem. 2012-07-13 [PMID: 22648407]

TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Species Glossary

Images

Product Details

Order Details

TIRAP (TLR2 and TLR4) Inhibitor Peptide Set Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-26245)(8)

Reviews for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-26245) (0)

Product General Protocols

FAQs for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-26245). (Showing 1 - 2 of 2 FAQs).

Additional TIRAP (TLR2 and TLR4) Products

Research Areas for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-26245)

Blogs on TIRAP (TLR2 and TLR4)

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Review this Product

Bioinformatics