Home » STEP » STEP Antibodies » STEP Antibody
Novus Biologicals products are now on bio-techne.com

STEP Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: STEP Antibody [NBP1-87186] - Staining of human caudate shows moderate cytoplasmic and nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: STEP Antibody [NBP1-87186] - Staining of human caudate shows moderate cytoplasmic and nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

STEP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PEDRRQSVSRQPSFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGL
Predicted Species
Mouse (94%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTPN5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
STEP Protein (NBP1-87186PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STEP Antibody

  • EC 3.1.3.48
  • FLJ14427
  • Neural-specific protein-tyrosine phosphatase
  • protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)
  • protein-tyrosine phosphatase striatum-enriched
  • PTPN5
  • STEP
  • STEPPTPSTEP
  • Striatum-enriched protein-tyrosine phosphatase
  • tyrosine-protein phosphatase non-receptor type 5

Background

The protein tyrosine phosphatase non-receptor type 5 or striatum-enriched protein-tyrosine phosphatase (STEP) protein is part of a family of protein tyrosine phosphatases enriched within the CNS, and is a key component of the NMDAR complex. It is expressed within dopaminoceptive neurons in the CNS and particularly enriched within the basal ganglia and related structures. STEP61 is the membrane-associated isoform and STEP46 is the cytosolic protein. In response to transient hypoxia-ischemia in the brain, STEP61 is proteolytically cleaved by calpain, thereby releasing a smaller isoform, STEP33.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NMDAR2B Antibody
NB300-106
Western Blot NMDAR2B Antibody
Flow Cytometry NMDAR2B Antibody
Western Blot NMDAR2B Antibody
(3 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
p38 gamma/SAPK3
Antibody [Unconjugate
AF1347
Immunocytochemistry p38 gamma/SAPK3 Antibody [Unconjugated]
Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]
Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]
(8 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western p38 alpha Antibody [Unconjugated]
Western Blot p38 alpha Antibody [Unconjugated]
Immunohistochemistry p38 alpha Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
PCPTP1 Antibody
NBP1-84912
Immunohistochemistry-Paraffin PCPTP1 Antibody
Immunohistochemistry-Paraffin PCPTP1 Antibody
Immunohistochemistry-Paraffin PCPTP1 Antibody
Species: Hu
Applications: IHC, IHC-P
Fyn Antibody
(FYN-01) - BSA Free
NB500-517
Immunoprecipitation Fyn Antibody (FYN-01) - BSA Free
Immunocytochemistry/ Immunofluorescence Fyn Antibody (FYN-01) - BSA Free
Immunocytochemistry/ Immunofluorescence Fyn Antibody (FYN-01) - BSA Free
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
GluR2 Antibody
(JU20-43)
NBP2-75510
Immunocytochemistry/ Immunofluorescence GluR2 Antibody (JU20-43)
Immunocytochemistry/ Immunofluorescence GluR2 Antibody (JU20-43)
Immunohistochemistry-Paraffin GluR2 Antibody (JU20-43)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Reg1A Antibody
(431202) [Unconjugate
MAB4937
Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Crk Antibody
(3G11E8) - BSA Free
NBP2-37568
ELISA Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
POLDIP2 Antibody
NBP1-68874
Western Blot POLDIP2 Antibody
Western Blot POLDIP2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
PTP pi/PTPRU
Antibody (764209)
MAB7475
Western Blot PTP pi/PTPRU Antibody (764209)
Western Blot PTP pi/PTPRU Antibody (764209)
(4 Publications)
Species: Hu, Rt
Applications: WB
AHSA1 Antibody
(1A2-A8)
H00010598-M01
Western Blot AHSA1 Antibody (1A2-A8)
Sandwich ELISA AHSA1 Antibody (1A2-A8)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
GRAP2 Antibody
(OTI1G2)
NBP2-00764
Flow Cytometry GRAP2 Antibody (OTI1G2)
Flow Cytometry GRAP2 Antibody (OTI1G2)
Western Blot GRAP2 Antibody (OTI1G2)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AIMP2 Antibody
NBP1-81575
Immunohistochemistry-Paraffin AIMP2 Antibody
Immunohistochemistry-Paraffin AIMP2 Antibody
Immunohistochemistry-Paraffin AIMP2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SLC25A3 Antibody
H00005250-B02P
Immunocytochemistry/ Immunofluorescence SLC25A3 Antibody
Western Blot SLC25A3 Antibody
Western Blot SLC25A3 Antibody
Species: Hu
Applications: ICC/IF, WB
NMDAR1 Antibody
(R1JHL) - Azide and B ...
NB300-118
Western Blot NMDAR1 Antibody (R1JHL) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence NMDAR1 Antibody (R1JHL) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence NMDAR1 Antibody (R1JHL) - Azide and BSA Free
(14 Reviews)
(21 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
STEP Antibody
NBP1-87186
STEP Antibody
Species: Hu, Mu, Rt
Applications: IHC

Publications for STEP Antibody (NBP1-87186) (0)

There are no publications for STEP Antibody (NBP1-87186).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STEP Antibody (NBP1-87186) (0)

There are no reviews for STEP Antibody (NBP1-87186). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for STEP Antibody (NBP1-87186) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STEP Products

Research Areas for STEP Antibody (NBP1-87186)

Find related products by research area.

Blogs on STEP

There are no specific blogs for STEP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STEP Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PTPN5