PCPTP1 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: YDPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHE |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PTPRR |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (84%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for PCPTP1 Antibody
Background
PCPTP1, also known as Receptor-type tyrosine-protein phosphatase R, has 4 isoforms, a 657 amino acid isoform that is 74 kDa, a 412 amino acid isoform t5hat is 47 k Da, a 451 amino acid isoform that is 51 kDa, and a 545 amino acid isoform that is 61 kDa, expressed in brain, placenta, small intestine, stomach, uterus and weakly in the prostate, sequesters mitogen-activated protein kinases (MAPKs) such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactive form. The MAPKs bind to a dephosphorylated kinase interacting motif, phosphorylation of which by the protein kinase A complex releases the MAPKs for activation and translocation into the nucleus. The protein is being studied for its involvement in colorectal cancer, episodic ataxia, ataxia, leukemia, prostatitis, and neuronitis. This protein has also been shown to involve MAPK1, MAPK14, MAPK3, MAPK7, and CDH2 in MAPK signaling pathway, EGFR1 Signaling Pathway, Signal transduction Erk Interactions- Inhibition of Erky, and Epithelial Adherens Junctions pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: ICC/IF, WB
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC
Publications for PCPTP1 Antibody (NBP1-84912) (0)
There are no publications for PCPTP1 Antibody (NBP1-84912).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PCPTP1 Antibody (NBP1-84912) (0)
There are no reviews for PCPTP1 Antibody (NBP1-84912).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for PCPTP1 Antibody (NBP1-84912) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PCPTP1 Products
Research Areas for PCPTP1 Antibody (NBP1-84912)
Find related products by research area.
|
Blogs on PCPTP1