![Western Blot: SPARC Antibody [NBP1-80972] - Analysis in human cell lines U2OS and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.](http://images.novusbio.com/fullsize/SPARC-Antibody-Western-Blot-NBP1-80972-img0010.jpg "Western Blot: SPARC Antibody [NBP1-80972] - Analysis in human cell lines U2OS and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL |
| Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SPARC |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. SPARC antibody validated for ICC/IF, WB from verified customer reviews. |
||
| Theoretical MW | 35 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunocytochemistry__Immunofluorescence_23325.jpg)
![Neutralization Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Block_Neutralize_8975.jpg)
![Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunohistochemistry_9333.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Sandra Vieira |
ICC | Human | 02/02/2015 |
Summary
|
||||||||
Enlarge |
reviewed by:
Sandra Vieira |
WB | Human | 02/02/2015 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for SPARC Antibody (NBP1-80972)Find related products by research area.
|
|
Caspase 8 - a key mediator of apoptosis Programmed cell death via apoptosis is a key controlled physiological process instigated by the cell death receptor family, their ligands, and the caspase cysteine protease family. All caspases exist in a precursor form that contains a prodomain, a... Read full blog post. |
|
GAPDH: More than a housekeeping gene GAPDH is a 146kD tetramer glycolytic pathway metabolic enzyme composed of four 30-40 kDa subunits. It is responsible for reversibly phosphorylating its substrate glyceraldehyde 3-phosphate within the glycolytic pathway. Apart from its role in gl... Read full blog post. |
|
GAPDH (Glyceraldehyde 3-Phosphate Dehydrogenase) GAPDH is a 146 kD tetramer glycolytic pathway metabolic enzyme responsible for reversibly phosphorylating glyceraldehyde 3-phosphate. It may have other possible functions in transcriptional activation. GAPDH is highly expressed due to this housekeepin... Read full blog post. |
|
FLICE, FLICE, baby Cell death via apoptosis is a fundamental cellular function triggered by the cell death receptor family and their ligands which signal through downstream adaptor molecules and the caspase protease family. All caspases exist in a precursor form compose... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Sandra Vieira 02/02/2015 |
||
| Application: | ICC | |
| Species: | Human |
| Sandra Vieira 02/02/2015 |
||
| Application: | WB | |
| Species: | Human |
![Western Blot: SPARC Antibody [NBP1-80972] - Analysis using Anti-SPARC antibody NBP1-80972 (A) shows similar pattern to independent antibody NBP1-80971 (B).](http://images.novusbio.com/fullsize/SPARC-Antibody-Western-Blot-NBP1-80972-img0013.jpg "Western Blot: SPARC Antibody [NBP1-80972] - Analysis using Anti-SPARC antibody NBP1-80972 (A) shows similar pattern to independent antibody NBP1-80971 (B).")
![Immunocytochemistry/Immunofluorescence: SPARC Antibody [NBP1-80972] - Staining SPARC in MG63 cells using anti-SPARC antibody. Cell were fixed in 4% Paraformaldehyde (20 min, RT); and permeabilized in 0,2% Triton (15 min, RT). Image from verified customer review.](http://images.novusbio.com/fullsize/SPARC-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80972-img0006.jpg "Immunocytochemistry/Immunofluorescence: SPARC Antibody [NBP1-80972] - Staining SPARC in MG63 cells using anti-SPARC antibody. Cell were fixed in 4% Paraformaldehyde (20 min, RT); and permeabilized in 0,2% Triton (15 min, RT). Image from verified customer review.")
![Immunohistochemistry-Paraffin: SPARC Antibody [NBP1-80972] - Staining of human placenta shows strong positivity in endothelial cells and fibroblasts.](http://images.novusbio.com/fullsize/SPARC-Antibody-Immunohistochemistry-Paraffin-NBP1-80972-img0011.jpg "Immunohistochemistry-Paraffin: SPARC Antibody [NBP1-80972] - Staining of human placenta shows strong positivity in endothelial cells and fibroblasts.")
![Western Blot: SPARC Antibody [NBP1-80972] - Analysis of SPARC MC3T3 (mouse), MG63 (human) cell lysates and conditions media using anti-SPARC antibody. Image from verified customer review.](http://images.novusbio.com/fullsize/SPARC-Antibody-Western-Blot-NBP1-80972-img0005.jpg "Western Blot: SPARC Antibody [NBP1-80972] - Analysis of SPARC MC3T3 (mouse), MG63 (human) cell lysates and conditions media using anti-SPARC antibody. Image from verified customer review.")
![Bioactivity IBSP/Sialoprotein II [Unconjugated]](https://images.novusbio.com/images/4014-sp_recombinant-human-ibsp-sialoprotein-ii-protein-cf-bioactivity-4420249391..jpg)
![N/A Thrombospondin-1 [HRP]](https://images.novusbio.com/images2/Thrombospondin-1_DTSP10_ELISA_199.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/DATA_MMP2_MMP200_ELISA_1003.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/MMP2_MMP200_ELISA_474.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images2/RUNX2_MAB2006_Immunocytochemistry_13309.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/CCL27_DCC270_ELISA_54.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/DATA_CCL27_DCC270_ELISA_615.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
