Sin1/MAPKAP1 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTARADYFAQKQRKLNRRTSFSFQKEKKSGQ |
Predicted Species |
Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MAPKAP1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Sin1/MAPKAP1 Antibody
Background
Sin1 is a novel component of the eukaryotic SAPK pathway. Sin1 and the H3 and H4 histones interact genetically, with the C terminus of Sin1 physically associating with components of the SWI-SNF complex. This interaction is blocked by the N-terminal half of the protein in full length Sin1. It has been proposed that Sin1 acts as a regulatable bridge between the SWI-SNF complex and the nucleosome Sin1 is also required for effective transcription via the AP-1 factor Pap1, but does not prevent its nuclear translocation. Sin1 is a novel component of the eukaryotic SAPK pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, ICC, ICC/IF, IF, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for Sin1/MAPKAP1 Antibody (NBP1-89568) (0)
There are no publications for Sin1/MAPKAP1 Antibody (NBP1-89568).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Sin1/MAPKAP1 Antibody (NBP1-89568) (0)
There are no reviews for Sin1/MAPKAP1 Antibody (NBP1-89568).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Sin1/MAPKAP1 Antibody (NBP1-89568) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Sin1/MAPKAP1 Products
Research Areas for Sin1/MAPKAP1 Antibody (NBP1-89568)
Find related products by research area.
|
Blogs on Sin1/MAPKAP1