Aquaporin-0 Antibody - BSA Free Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MIP (NP_036196.1). LALATLVQSVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPAVSVGQATTVEIFLTLQFVLCIFATYD |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MIP |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:100-1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500-1:1000
|
Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Aquaporin-0 Antibody - BSA Free
Background
Aquaporins (AQPs) are a large family of integral membrane channel proteins that facilitate the transport of water through the cell membrane. Aquaporins are widely distributed and are involved in renal water absorption, generation of pulmonary secretions, lacrimation and the secretion and reabsorption of cerebrospinal fluid and aqueous humor. AQP0 is the most abundant endogenous protein in the plasma membrane of lens fiber cells where it functions not only as a water pore, but it is also involved in fiber-fiber adhesion and is crucial for fiber cell structure and organization. AQP0 contains an additional pore constriction, not seen in any other aquaporin structures, which may be responsible for pore gating. The closed AQP0 pore holds just three water molecules, which are spaced too far apart to form hydrogen bonds with each other. The C-terminal domain of AQP0 undergoes extensive post-translational modification, including many truncations, during lens aging due to the actions of m-Calpain, proteases or non-enzymatic mechanisms. These truncation sites may be involved in the development of cataracts.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: WB, IHC
Publications for Aquaporin-0 Antibody (NBP2-92773) (0)
There are no publications for Aquaporin-0 Antibody (NBP2-92773).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Aquaporin-0 Antibody (NBP2-92773) (0)
There are no reviews for Aquaporin-0 Antibody (NBP2-92773).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Aquaporin-0 Antibody (NBP2-92773) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Aquaporin-0 Products
Research Areas for Aquaporin-0 Antibody (NBP2-92773)
Find related products by research area.
|
Blogs on Aquaporin-0