Western Blot: TORC1 Antibody [NBP1-89865] - Analysis in mouse cell line NIH-3T3 cell and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: TORC1 Antibody [NBP1-89865] - Staining of human cell line A-431 shows localization to nucleoplasm, nuclear bodies, plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferous ducts.
Western Blot: TORC1 Antibody [NBP1-89865] - Analysis in human cell line BEWO.
Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865] - Staining of human prostate shows strong nuclear positivity in smooth muscle cells.
This antibody was developed against Recombinant Protein corresponding to amino acids: SPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRTC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for TORC1 Antibody
CREB regulated transcription coactivator 1
CRTC1
FLJ14027WAMTP1
KIAA0616Transducer of regulated cAMP response element-binding protein 1
MECT1
MECT1CREB-regulated transcription coactivator 1
mucoepidermoid carcinoma translocated 1
Mucoepidermoid carcinoma translocated protein 1
TORC1
TORC1TORC-1
Transducer of CREB protein 1
transducer of regulated cAMP response element-binding protein (CREB) 1
WAMTP1
Background
MECT1 (also known as MucoEpidermoid Carcinoma Translocated 1, Transducer of regulated cAMP response element-binding protein 1, TORC1, and Transducer of CREB protein 1) is a nuclear protein that functions as a transcriptional coactivator for CREB1, which activates transcription through both consensus and variant cAMP response element (CRE) sites. MECT1does not appear to modulate CREB1 DNA-binding activity but enhances the interaction of CREB1 with TAF4/TAFII-130. MECT1 translocates with MAML2 (MasterMind-Like Protein 2) to yield a fusion oncogene: t(11;19) (q21;p13). This translocation occurs in mucoepidermoid carcinomas, benign Warthin tumors and clear cell hidradenomas. The novel fusion product that results disrupts the Notch signaling pathway. The fusion protein consists of the N-terminus of MECT1 joined to the C-terminus of MAML2. The reciprocal fusion protein consisting of the N-terminus of MAML2 joined to the C-terminus of MECT1 has been detected in a small number of mucoepidermoid carcinomas. Multiple isoforms have been reported for the MECT1 protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our TORC1 Antibody and receive a gift card or discount.