![Immunohistochemistry-Paraffin: heavy chain Myosin Antibody [NBP1-89707] - Staining of human placenta shows no positivity in trophoblastic cells as expected.](http://images.novusbio.com/fullsize/heavy-chain-Myosin-Antibody-Immunohistochemistry-Paraffin-NBP1-89707-img0004.jpg "Immunohistochemistry-Paraffin: heavy chain Myosin Antibody [NBP1-89707] - Staining of human placenta shows no positivity in trophoblastic cells as expected.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAML |
| Predicted Species | Mouse (96%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MYH3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Immunohistochemistry_19508.jpg)
![Western Blot MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Western_Blot_19525.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Myosin Heavy Chain 3 Antibody (NBP1-89707)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYH3 |
![Immunohistochemistry-Paraffin: heavy chain Myosin Antibody [NBP1-89707] - Staning of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/heavy-chain-Myosin-Antibody-Immunohistochemistry-Paraffin-NBP1-89707-img0001.jpg "Immunohistochemistry-Paraffin: heavy chain Myosin Antibody [NBP1-89707] - Staning of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: heavy chain Myosin Antibody [NBP1-89707] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes](http://images.novusbio.com/fullsize/heavy-chain-Myosin-Antibody-Immunohistochemistry-Paraffin-NBP1-89707-img0002.jpg "Immunohistochemistry-Paraffin: heavy chain Myosin Antibody [NBP1-89707] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes")
![Immunohistochemistry-Paraffin: heavy chain Myosin Antibody [NBP1-89707] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/heavy-chain-Myosin-Antibody-Immunohistochemistry-Paraffin-NBP1-89707-img0003.jpg "Immunohistochemistry-Paraffin: heavy chain Myosin Antibody [NBP1-89707] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")