Myosin Heavy Chain 1 Antibody - Azide and BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MYH1 (NP_005954.3). MSSDSEMAIFGEAAPFLRKSERERIEAQNKPFDAKTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPKYDKIEDMAMMTHLHEP |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MYH1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 1:100 - 1:500
|
Theoretical MW |
223 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.09% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Myosin Heavy Chain 1 Antibody - Azide and BSA Free
Background
The Myosin family includes a number of ATP-driven motor proteins involved in muscle contration and actin-dependent cellular motility. Although they were originally thought to be limited to muscle tissues, new genes sharing basic myosin superfamily properties have since been identifed nearly all eukaryotic cell types. The myosin proteins are spearated into 18 different classes, which have been found to be highly conserved across species. Myosin antibodies are commonly used for cell motility, ATP hydrolysis and muscle studies, as well as loading controls.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: PEP-ELISA, WB
Publications for Myosin Heavy Chain 1 Antibody (NBP2-95223) (0)
There are no publications for Myosin Heavy Chain 1 Antibody (NBP2-95223).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Myosin Heavy Chain 1 Antibody (NBP2-95223) (0)
There are no reviews for Myosin Heavy Chain 1 Antibody (NBP2-95223).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Myosin Heavy Chain 1 Antibody (NBP2-95223) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Myosin Heavy Chain 1 Products
Research Areas for Myosin Heavy Chain 1 Antibody (NBP2-95223)
Find related products by research area.
|
Blogs on Myosin Heavy Chain 1