tropomyosin-2 Antibody - Azide and BSA Free Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human tropomyosin-2 (NP_003280.2). MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELD |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
TPM2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50-1:100
- Immunohistochemistry 1:50-1:100
- Immunohistochemistry-Paraffin
- Immunoprecipitation 1:500 - 1:1000
- Western Blot 1:500-1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for tropomyosin-2 Antibody - Azide and BSA Free
Background
The tropomyosin-2 gene encodes beta-tropomyosin, a member of the actin filament binding protein family, and mainly expressed in slow, type 1 muscle fibers. Mutations in this gene can alter the expression of other sarcomeric tropomyosin proteins, and cause cap disease,
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Po, Rt
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Al, Am, Av, Bv, Ch, Fi, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, ChHa, Dr, Fu, Hu, Mu, Pl, Pr, Rb, Rt, Sh, Xp, Ye, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, In
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for tropomyosin-2 Antibody (NBP2-95197) (0)
There are no publications for tropomyosin-2 Antibody (NBP2-95197).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for tropomyosin-2 Antibody (NBP2-95197) (0)
There are no reviews for tropomyosin-2 Antibody (NBP2-95197).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for tropomyosin-2 Antibody (NBP2-95197) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional tropomyosin-2 Products
Research Areas for tropomyosin-2 Antibody (NBP2-95197)
Find related products by research area.
|
Blogs on tropomyosin-2