![Immunohistochemistry-Paraffin: MYH6 Antibody [NBP1-88120] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in a subset of myocytes.](http://images.novusbio.com/fullsize/MYH6-Antibody-Immunohistochemistry-Paraffin-NBP1-88120-img0010.jpg "Immunohistochemistry-Paraffin: MYH6 Antibody [NBP1-88120] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in a subset of myocytes.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA |
| Predicted Species | Mouse (97%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MYH6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Immunohistochemistry_19508.jpg)
![Western Blot MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Western_Blot_19525.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for MYH6 Antibody (NBP1-88120)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYH6 |
![Immunohistochemistry-Paraffin: MYH6 Antibody [NBP1-88120] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in a subset of myocytes.](http://images.novusbio.com/fullsize/MYH6-Antibody-Immunohistochemistry-Paraffin-NBP1-88120-img0005.jpg "Immunohistochemistry-Paraffin: MYH6 Antibody [NBP1-88120] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in a subset of myocytes.")
![Immunohistochemistry-Paraffin: MYH6 Antibody [NBP1-88120] - Analysis in human heart muscle and endometrium tissues. Corresponding MYH6 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MYH6-Antibody-Immunohistochemistry-Paraffin-NBP1-88120-img0006.jpg "Immunohistochemistry-Paraffin: MYH6 Antibody [NBP1-88120] - Analysis in human heart muscle and endometrium tissues. Corresponding MYH6 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: MYH6 Antibody [NBP1-88120] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/MYH6-Antibody-Immunohistochemistry-Paraffin-NBP1-88120-img0007.jpg "Immunohistochemistry-Paraffin: MYH6 Antibody [NBP1-88120] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: MYH6 Antibody [NBP1-88120] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/MYH6-Antibody-Immunohistochemistry-Paraffin-NBP1-88120-img0008.jpg "Immunohistochemistry-Paraffin: MYH6 Antibody [NBP1-88120] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: MYH6 Antibody [NBP1-88120] - Staining of human prostate shows no positivity in smooth muscle cells as expected.](http://images.novusbio.com/fullsize/MYH6-Antibody-Immunohistochemistry-Paraffin-NBP1-88120-img0009.jpg "Immunohistochemistry-Paraffin: MYH6 Antibody [NBP1-88120] - Staining of human prostate shows no positivity in smooth muscle cells as expected.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Western Blot NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-4120241239327.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412401270.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412403531.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")