![Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Analysis in human heart muscle and pancreas tissues. Corresponding Myosin Light Chain 2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Myosin-Light-Chain-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85541-img0008.jpg "Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Analysis in human heart muscle and pancreas tissues. Corresponding Myosin Light Chain 2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MYL2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2), 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Immunohistochemistry_19508.jpg)
![Western Blot MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Western_Blot_19525.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC-Fr | Mouse | 01/07/2021 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Myosin Light Chain 2 Antibody (NBP1-85541)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYL2 |
![Western Blot: Myosin Light Chain 2 Antibody [NBP1-85541] - Analysis in human heart tissue.](http://images.novusbio.com/fullsize/Myosin-Light-Chain-2-Antibody-Western-Blot-NBP1-85541-img0011.jpg "Western Blot: Myosin Light Chain 2 Antibody [NBP1-85541] - Analysis in human heart tissue.")
![Immunohistochemistry-Frozen: Myosin Light Chain 2 Antibody [NBP1-85541] - Mlc2v staining on E11.5 mouse Right Ventricle. Fixed 4% PFA overnight. Blocked with 1% BSA. Primary antibody at 1ug/mL. Secondary antibody at 1:1000, conjugated to Alexa Fluor 488. Image submitted by a verified customer review.](http://images.novusbio.com/fullsize/Myosin-Light-Chain-2-Antibody-Immunohistochemistry-Frozen-NBP1-85541-img0014.jpg "Immunohistochemistry-Frozen: Myosin Light Chain 2 Antibody [NBP1-85541] - Mlc2v staining on E11.5 mouse Right Ventricle. Fixed 4% PFA overnight. Blocked with 1% BSA. Primary antibody at 1ug/mL. Secondary antibody at 1:1000, conjugated to Alexa Fluor 488. Image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/Myosin-Light-Chain-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85541-img0009.jpg "Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Myosin-Light-Chain-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85541-img0010.jpg "Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry: Myosin Light Chain 2 Antibody [NBP1-85541] - Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/Myosin-Light-Chain-2-Antibody-Immunohistochemistry-NBP1-85541-img0012.jpg "Immunohistochemistry: Myosin Light Chain 2 Antibody [NBP1-85541] - Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.")
![Immunohistochemistry: Myosin Light Chain 2 Antibody [NBP1-85541] - Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Myosin-Light-Chain-2-Antibody-Immunohistochemistry-NBP1-85541-img0013.jpg "Immunohistochemistry: Myosin Light Chain 2 Antibody [NBP1-85541] - Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Western Blot NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-4120241239327.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412401270.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412403531.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
