We are working on a Sandwich ELISA platform for AMH assay. We have the following queries regarding the AMH antibodies: 1. Do you recommend any pairs of the antibodies for Sandwich Elisa platform for Human AMH protein detection? 2. Were the antibodies raised against recombinant protein or synthetic peptide or Native AMH protein? 3. What was the molecular weight of the AMH protein (140KDa or 22KDa) used to check the specificity of the antibodies?

Name: MIS/AMH Antibody
Brand: Novus Biologicals
SKU: NBP1-70639
Price: 399 USD

Question

Accepted Answer

In regards to your sandwich ELISA inquiry, I was able to find a potential pair of antibodies that may work for your experiment (catalog numbers NBP1-70639 and NBP2-11800). Neither of these antibodies has been tested in ELISA or as a pair, so we cannot guarantee them in this application. The monoclonal antibody was raised against the human recombinant AMH protein. The polyclonal was raised against an AMH peptide. Since we do not epitope map the monoclonal, we cannot say for certain that it will not bind to a similar region as the polyclonal. If you would like to test these in ELISA, then I can recommend our Innovator's Reward program. The theoretical and observed molecular weight for this protein is 59kDa. You can find more information on UniProt about this protein: UniProt P03971.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	WB, IHC
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated
Concentration	0.5 mg/ml

Description	The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen	Synthetic peptides corresponding to AMH(anti-Mullerian hormone) The peptide sequence was selected from the middle region of AMH. Peptide sequence SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG. The peptide sequence for this immunogen was taken from within the described region.
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	AMH
Purity	Affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Dilutions	Immunohistochemistry 1:10-1:500 Immunohistochemistry-Paraffin 1:10-1:500 Western Blot 1.0 ug/ml
Theoretical MW	60 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS, 2% Sucrose
Preservative	0.09% Sodium Azide
Concentration	0.5 mg/ml
Purity	Affinity purified

MIS/AMH Antibody

Species Glossary

Images

Product Details

Order Details

MIS/AMH Antibody Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for MIS/AMH Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for MIS/AMH Antibody (NBP1-70639) (0)

Reviews for MIS/AMH Antibody (NBP1-70639) (0)

Product General Protocols

Video Protocols

FAQs for MIS/AMH Antibody (NBP1-70639). (Showing 1 - 1 of 1 FAQ).

Secondary Antibodies

Isotype Controls

Additional MIS/AMH Products

Blogs on MIS/AMH

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics