Orthogonal Strategies: Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-251 MG and human cell line RT-4.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-87 MG.
Western Blot: PLOD1 Antibody [NBP2-38770] - SC65 directly interacts with lysyl-hydroxylase 1 (LH1). Western blot of primary calvarial osteoblast and skin fibroblast lysates from WT and Sc65KO 3 day-old mice (N = 2) ...read more
SC65 directly interacts with lysyl-hydroxylase 1 (LH1). b) Western blot of primary calvarial osteoblast and skin fibroblast lysates from WT and Sc65KO 3 day-old mice (N = 2) showing significantly decreased levels of LH1 ...read more
This antibody was developed against a recombinant protein corresponding to amino acids: FVSLFFQRLLRLHYPQKHMRLFIHNHEQHHKAQVEEFLAQHGSEYQSVKLVGPEVRMANADARN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLOD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Mouse reactivity reported in scientific literature (PMID: 27119146). Immunogen displays the following percentage of sequence identity for non-tested species: Rat (84%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Lysyl hydroxylase is a membrane-bound homodimeric protein localized to the cisternae of the endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VI have deficiencies in lysyl hydroxylase activity. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our PLOD1 Antibody and receive a gift card or discount.