MEKK1 Antibody (2F6) - IHC-Prediluted Summary
Description |
The prediluted antibody does not require any mixing, dilution, reconstitution, or titration; the antibody is ready-to-use and optimized for staining. |
Immunogen |
Partial recombinant MEKK1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) (Uniprot: Q13233) |
Localization |
Cytoplasmic |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
MAP3K1 |
Purity |
Protein A or G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
|
Application Notes |
Immunohistochemistry (Formalin-fixed): 1-2ug/ml for 30 minutes at RT. Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris Buffer with 1mM EDTA, pH 9.0, for 45 min at 95C followed by cooling at RT for 20 minutes. Optimal dilution for a specific application should be determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C. |
Buffer |
10 mM PBS with 0.05% BSA |
Preservative |
0.05% Sodium Azide |
Purity |
Protein A or G purified |
Alternate Names for MEKK1 Antibody (2F6) - IHC-Prediluted
Background
MEKKs (Mitogen activated protein kinase kinase kinases) are serine-threonine kinases that act as the first tier of cellular MAP kinase pathways by activation of MAP/ERK kinases, or MEKs. Many enzymes with MEKK activity have been identified, including MEKK1-4, Raf, MLK3, TAK, and DLK. MEKKs generally display little similarity outside of their catalytic kinase domains. MEKK1-4 are nearly 50% identical within their catalytic domains, and are known to regulate Erk, Jnk, and p38 MAP kinase pathways. MEKK2 and MEKK3 bind MEK5 via conserved PB1 domains, leading to downstream activation of Erk5.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Publications for MEKK1 Antibody (NBP2-48208) (0)
There are no publications for MEKK1 Antibody (NBP2-48208).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MEKK1 Antibody (NBP2-48208) (0)
There are no reviews for MEKK1 Antibody (NBP2-48208).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for MEKK1 Antibody (NBP2-48208) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MEKK1 Products
Research Areas for MEKK1 Antibody (NBP2-48208)
Find related products by research area.
|
Blogs on MEKK1