Reactivity | HuSpecies Glossary |
Applications | WB, IHC |
Clone | 2F6 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Format | Azide and BSA Free |
Concentration | 1.0 mg/ml |
Description | 1.0 mg/ml of antibody purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS WITHOUT BSA & azide. Also available at 200 ug/ml WITH BSA & azide (NBP2-44405). Antibody with azide - store at 2 to 8C. Antibody without azide - store at -20 to -80C. |
Immunogen | Partial recombinant MEKK1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) (Uniprot: Q13233) |
Localization | Cytoplasmic |
Isotype | IgG2a Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | MAP3K1 |
Purity | Protein A or G purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Immunohistochemistry (Formalin-fixed): 1-2ug/ml for 30 minutes at RT. Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris Buffer with 1mM EDTA, pH 9.0, for 45 min at 95C followed by cooling at RT for 20 minutes. Optimal dilution for a specific application should be determined. |
Storage | Store at -20 to -80C. Avoid freeze-thaw cycles. |
Buffer | 10 mM PBS |
Preservative | No Preservative |
Concentration | 1.0 mg/ml |
Purity | Protein A or G purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MEKK1 Antibody (NBP2-47810)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | MAP3K1 |