Reactivity | Hu, RtSpecies Glossary |
Applications | ICC/IF, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMN |
Predicted Species | Rat (90%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | CHUK |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for IKK alpha Antibody (NBP1-89634)Find related products by research area.
|
IKK alpha says "no" to NFk beta The nuclear factor kappa B (NFkB) is a ubiquitous transcription factor essential for the activation of immune and inflammatory responses. NFkB activity is inhibited when it is associated with IkB proteins in the cell cytoplasm. IkB proteins are phosph... Read full blog post. |
Regulating Immune Response Pathways with IKK beta IKK beta, also known as IKK2, activates the NFkB complex by phosphorylating the NFkB inhibitor, IkBa. Several transcript variants, some protein-coding and some not, have been found for IKKB. The Nuclear Factor-kappa B (NF-kB) family of transcription f... Read full blog post. |
IKK alpha: Roles in Development, B-cell Survival and ESC Differentiation Inhibitor of nuclear factor kappa-B kinase subunit alpha (IKK1 alpha) is a serine/threonine kinase that forms a complex with IKK beta and NEMO. It plays an essential role in embryonic skin development. Mice with low levels of IKKa show an increase in ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CHUK |