Home » HYPB » HYPB Antibodies » HYPB Antibody - Azide and BSA Free
Novus Biologicals products are now on bio-techne.com

HYPB Antibody - Azide and BSA Free

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: HYPB Antibody [NBP3-03807] - Analysis of U-2 OS cells using HYPB antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: HYPB Antibody [NBP3-03807] - Analysis of U-2 OS cells using HYPB antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: HYPB Antibody [NBP3-03807] - Analysis of C6 cells using HYPB antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: HYPB Antibody [NBP3-03807] - analysis of lysates from Mouse spleen, using SETD2 Rabbit pAb at 1:900 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug ...read more
Immunoprecipitation- HYPB Antibody [NBP3-03807] - Analysis of 600 μg extracts of Mouse spleen using 3 μg SETD2 antibody. Western blot was performed from the immunoprecipitate using SETD2 antibody at a dilution of ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price
Azide and BSA Free
NBP3-03807-20ul
Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HYPB Antibody - Azide and BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 2475-2564 of human HYPB (NP_054878.5). RKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SETD2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunoprecipitation 0.5ug-4ug antibody for 400ug-600ug extracts of whole cells
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.05% Proclin 300
Purity
Affinity purified

Alternate Names for HYPB Antibody - Azide and BSA Free

  • FLJ22472
  • FLJ23184
  • FLJ45883
  • FLJ46217
  • HIF1
  • HIF-1EC 2.1.1.43
  • HIP-1
  • histone-lysine N-methyltransferase SETD2
  • hSET2
  • huntingtin interacting protein 1
  • Huntingtin yeast partner B
  • Huntingtin-interacting protein 1
  • Huntingtin-interacting protein B
  • HYPBp231HBP
  • KIAA1732SET domain-containing protein 2
  • KMT3AHBP231
  • Lysine N-methyltransferase 3A
  • SET domain containing 2
  • SET2FLJ16420

Background

Huntington's disease (HD), a neurodegenerative disorder characterized by loss of striatal neurons, is caused by an expansion of a polyglutamine tract in the HD protein huntingtin. This gene encodes a protein belonging to a class of huntingtin interacting proteins characterized by WW motifs. This protein is a histone methyltransferase that is specific for lysine-36 of histone H3, and methylation of this residue is associated with active chromatin. This protein also contains a novel transcriptional activation domain and has been found associated with hyperphosphorylated RNA polymerase II. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

HIF-1 alpha
Antibody (H1alpha67)
NB100-105
Western Blot HIF-1 alpha Antibody (H1alpha67)
Flow Cytometry HIF-1 alpha Antibody (H1alpha67)
Flow Cytometry HIF-1 alpha Antibody (H1alpha67)
(45 Reviews)
(1043 Publications)
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(684 Publications)
Species: Hu
Applications: ELISA
ARNT/HIF-1 beta
Antibody (H1beta234) ...
NB100-124
Western Blot ARNT/HIF-1 beta Antibody (H1beta234) - BSA Free
Western Blot ARNT/HIF-1 beta Antibody (H1beta234) - BSA Free
Immunocytochemistry/ Immunofluorescence ARNT/HIF-1 beta Antibody (H1beta234) - BSA Free
(4 Reviews)
(106 Publications)
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: ChIP, CHIP-SEQ, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
Erythropoietin/EPO
[HRP]
MEP00B
N/A Erythropoietin/EPO [HRP]
N/A Erythropoietin/EPO [HRP]
(105 Publications)
Species: Mu
Applications: ELISA
Von Hippel Lindau
Antibody (OTI1E1)
NBP2-45411
Immunohistochemistry Von Hippel Lindau Antibody (OTI1E1)
Immunohistochemistry Von Hippel Lindau Antibody (OTI1E1)
Immunohistochemistry Von Hippel Lindau Antibody (OTI1E1)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Glut1 Antibody -
BSA Free
NB110-39113
Western Blot Glut1 Antibody - BSA Free
Flow Cytometry Glut1 Antibody - BSA Free
Western Blot Glut1 Antibody - BSA Free
(7 Reviews)
(62 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
TIMP-1 [HRP]
DTM100
N/A TIMP-1 [HRP]
N/A TIMP-1 [HRP]
(97 Publications)
Species: Hu
Applications: ELISA
HIF-2 alpha/EPAS1
Antibody - BSA Free
NB100-122
Immunohistochemistry HIF-2 alpha/EPAS1 Antibody - BSA Free
Immunohistochemistry HIF-2 alpha/EPAS1 Antibody - BSA Free
Western Blot HIF-2 alpha/EPAS1 Antibody - BSA Free
(37 Reviews)
(826 Publications)
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
EPX Antibody
(rEPO104)
NBP3-07388
Immunohistochemistry-Paraffin EPX Antibody (rEPO104)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Carbonic Anhydrase
IX/CA9 Antibody - BSA ...
NB100-417
Flow Cytometry Carbonic Anhydrase IX/CA9 Antibody - BSA Free
Immunoblotting Carbonic Anhydrase IX/CA9 Antibody - BSA Free
Immunoblotting Carbonic Anhydrase IX/CA9 Antibody - BSA Free
(7 Reviews)
(284 Publications)
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, PLA, Simple Western, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
HYPB Antibody -
Azide and BSA Free
NBP3-03807
HYPB Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP

Publications for HYPB Antibody (NBP3-03807) (0)

There are no publications for HYPB Antibody (NBP3-03807).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HYPB Antibody (NBP3-03807) (0)

There are no reviews for HYPB Antibody (NBP3-03807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HYPB Antibody (NBP3-03807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HYPB Products

Array NBP3-03807

Blogs on HYPB

There are no specific blogs for HYPB, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HYPB Antibody - Azide and BSA Free and receive a gift card or discount.


Bioinformatics

Gene Symbol SETD2