![Western Blot: ERCC1 Antibody (CL1284) [NBP2-34480] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ERCC1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/ERCC1-Antibody-CL1284-Western-Blot-NBP2-34480-img0008.jpg "Western Blot: ERCC1 Antibody (CL1284) [NBP2-34480] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ERCC1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, IHC, KD |
| Clone | CL1284 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP |
| Epitope | KARRLFDVLH |
| Predicted Species | Mouse (92%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ERCC1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ERCC1 Antibody (NBP2-34480)Find related products by research area.
|
|
Beta Tubulin III and neurogenesis Beta tubulin III, also known as Tuj-1, is a class III member of the beta tubulin protein family. Beta tubulins are one of two structural components that form our microtubule network. While general tubulins play a role in a wide range of cellular pr... Read full blog post. |
|
53BP1 - a marker for DNA Double Strand Break 53BP1 (p53 binding protein 1) was originally thought to be an enhancer for p53 transcriptional, but later studies have demonstrated that it is actually a substrate for ataxia telangiectasia mutated (ATM). 53BP1 is a classic late DNA damage response... Read full blog post. |
|
53BP1 - DNA damage is no fun The 53BP1 (p53 binding protein 1) was initially believed to be a p53 transcriptional enhancing partner, but it has now been established as an ataxia telangiectasia mutated (ATM) substrate. As a late DNA damage response (DDR) marker, 53BP1 appears duri... Read full blog post. |
|
Using PCNA as an Antibody Marker PCNA antibodies are useful biomarkers in DNA repair studies. PCNA is one of several proteins essential for the completion of nucleotide excision repair, a multi-stage process involving 20 - 30 proteins, and an important factor in repairing damage and ... Read full blog post. |
|
NER Antibodies in Cancer Research We at Novus Biologicals have over 230 products in our antibody catalog devoted to nucleotide excision repair. NER is a multi-stage sequential process involving over 30 proteins, all of which have been widely studied. Being the primary method to repair... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: ERCC1 Antibody (CL1284) [NBP2-34480] - Lane 1: Marker [kDa] Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize/ERCC1-Antibody-CL1284-Western-Blot-NBP2-34480-img0009.jpg "Western Blot: ERCC1 Antibody (CL1284) [NBP2-34480] - Lane 1: Marker [kDa] Lane 2: Human cell line RT-4")
![Immunohistochemistry-Paraffin: ERCC1 Antibody (CL1284) [NBP2-34480] - Staining of human colon shows nuclear immunoreactivity in both glandular and lymphoid cells.](http://images.novusbio.com/fullsize/ERCC1-Antibody-CL1284-Immunohistochemistry-NBP2-34480-img0005.jpg "Immunohistochemistry-Paraffin: ERCC1 Antibody (CL1284) [NBP2-34480] - Staining of human colon shows nuclear immunoreactivity in both glandular and lymphoid cells.")
![Immunohistochemistry-Paraffin: ERCC1 Antibody (CL1284) [NBP2-34480] - Staining of human colorectal cancer shows strong nuclear immunoreactivity in tumor cells.](http://images.novusbio.com/fullsize/ERCC1-Antibody-CL1284-Immunohistochemistry-NBP2-34480-img0001.jpg "Immunohistochemistry-Paraffin: ERCC1 Antibody (CL1284) [NBP2-34480] - Staining of human colorectal cancer shows strong nuclear immunoreactivity in tumor cells.")
![Immunohistochemistry-Paraffin: ERCC1 Antibody (CL1284) [NBP2-34480] - Staining of human ventricular cancer shows strong nuclear positivity in tumor cells.](http://images.novusbio.com/fullsize/ERCC1-Antibody-CL1284-Immunohistochemistry-NBP2-34480-img0002.jpg "Immunohistochemistry-Paraffin: ERCC1 Antibody (CL1284) [NBP2-34480] - Staining of human ventricular cancer shows strong nuclear positivity in tumor cells.")
![Immunohistochemistry-Paraffin: ERCC1 Antibody (CL1284) [NBP2-34480] - Staining of human prostate cancer shows strong nuclear immunoreactivity in tumor cells.](http://images.novusbio.com/fullsize/ERCC1-Antibody-CL1284-Immunohistochemistry-NBP2-34480-img0003.jpg "Immunohistochemistry-Paraffin: ERCC1 Antibody (CL1284) [NBP2-34480] - Staining of human prostate cancer shows strong nuclear immunoreactivity in tumor cells.")
![Immunohistochemistry-Paraffin: ERCC1 Antibody (CL1284) [NBP2-34480] - Staining of human testis shows strong nuclear positivity in seminiferous tubules.](http://images.novusbio.com/fullsize/ERCC1-Antibody-CL1284-Immunohistochemistry-NBP2-34480-img0004.jpg "Immunohistochemistry-Paraffin: ERCC1 Antibody (CL1284) [NBP2-34480] - Staining of human testis shows strong nuclear positivity in seminiferous tubules.")
![Simple Western: ERCC1 Antibody (CL1284) [NBP2-34480] - Simple Western lane view shows a specific band for ADARB1 in 0.2 mg/ml of RT-4, U-251MG sp lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system. *Non-specific interaction with the 230 kDa standard may be seen with this antibody.](http://images.novusbio.com/fullsize/ERCC1-Antibody-CL1284-Simple-Western-NBP2-34480-img0007.jpg "Simple Western: ERCC1 Antibody (CL1284) [NBP2-34480] - Simple Western lane view shows a specific band for ADARB1 in 0.2 mg/ml of RT-4, U-251MG sp lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system. *Non-specific interaction with the 230 kDa standard may be seen with this antibody.")
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")