Novus Biologicals products are now on bio-techne.com

APE Recombinant Protein Antigen

Images

 
There are currently no images for APE Recombinant Protein Antigen (NBP2-76495PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

APE Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human APE.

Source: E. coli

Amino Acid Sequence: DKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQEGAPHR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
APEX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-76495.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for APE Recombinant Protein Antigen

  • AP endonuclease 1
  • APE
  • APE1
  • APE-1
  • APEAPEX nuclease (multifunctional DNA repair enzyme)
  • APENAP endonuclease class I
  • APEX deoxyribonuclease (apurinic or apyrimidinic)
  • APEX nuclease (multifunctional DNA repair enzyme) 1
  • APEX nuclease
  • APEX1
  • Apurinic-apyrimidinic endonuclease 1
  • APXAP lyase
  • DNA-(apurinic or apyrimidinic site) lyase
  • EC 3.1
  • EC 4.2.99.18
  • HAP1apurinic/apyrimidinic (abasic) endonuclease
  • multifunctional DNA repair enzyme
  • protein REF-1
  • redox factor 1
  • Redox factor-1
  • REF1 apurinic/apyrimidinic exonuclease
  • REF-1

Background

DNA-(apurinic or apyrimidinic site) lyase, also known as APE1 or APEX1, is a multifunctional mammalian proteins responsible for the cellular response to oxidative stress. Specifically, APE-1 both functions in the DNA base excision repair pathway and regulates the redox of transcriptional factors.

For DNA repair, APE1 functions as a mammalian apurinic/apyrimidinic (AP) endodeoxyribonuclease responsible for the repair of AP sites in DNA lesions induced by oxidative and alkylating agents.

APEX1 also exerts a reversible nuclear redox activity to regulate the DNA binding affinity and the activity of transcriptional factors by regulating the redox status of their DNA-binding domains.

APE1 antibodies are useful for studies on both DNA repair and transcriptional regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-106
Species: Hu, Mu, Po, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-38600
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87154
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-16182
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2214
Species: Hu
Applications: ICC, IHC, WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-1031
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-76495PEP
Species: Hu
Applications: AC

Publications for APE Recombinant Protein Antigen (NBP2-76495PEP) (0)

There are no publications for APE Recombinant Protein Antigen (NBP2-76495PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APE Recombinant Protein Antigen (NBP2-76495PEP) (0)

There are no reviews for APE Recombinant Protein Antigen (NBP2-76495PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for APE Recombinant Protein Antigen (NBP2-76495PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional APE Products

Research Areas for APE Recombinant Protein Antigen (NBP2-76495PEP)

Find related products by research area.

Blogs on APE

There are no specific blogs for APE, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our APE Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol APEX1