AMPK beta 1 Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human AMPK beta 1 (NP_006244.2). MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPT |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PRKAB1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
- Knockout Validated
- Western Blot 1:500 - 1:2000
|
Theoretical MW |
30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS with 50% glycerol, pH7.3. |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for AMPK beta 1 Antibody - BSA Free
Background
The 5'-AMP-activated protein kinase (AMPK), a member of the SNF1 (sucrose non-fermentor) kinase family (1). AMPK is a heterotrimeric protein comprising alpha (63 kDa), beta (38 kDa) and gamma (38 kDa) subunits (2). The alpha subunit is the catalytic subunit, while beta and gamma are non-catalytic subunits, although they have been found to interact with the active subunit in liver. AMPK regulates fatty acid and sterol synthesis by phosphorylation of acetyl-CoA as well as cholesterol synthesis via phosphorylation and inactivation of hydroxymethylglutaryl-CoA reductase (3). AMPK beta-1 mediates the association of the AMPK heterotrimeric complex in vitro (2). Two isoforms have been found and the difference in expression patterns indicates tissue-specific roles for these isoforms (4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: BA
Publications for AMPK beta 1 Antibody (NBP2-92961) (0)
There are no publications for AMPK beta 1 Antibody (NBP2-92961).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AMPK beta 1 Antibody (NBP2-92961) (0)
There are no reviews for AMPK beta 1 Antibody (NBP2-92961).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AMPK beta 1 Antibody (NBP2-92961) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional AMPK beta 1 Products
Research Areas for AMPK beta 1 Antibody (NBP2-92961)
Find related products by research area.
|
Blogs on AMPK beta 1