![Western Blot: ABCF1 Antibody [NBP1-89314] - Western blot analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/ABCF1-Antibody-Western-Blot-NBP1-89314-img0014.jpg "Western Blot: ABCF1 Antibody [NBP1-89314] - Western blot analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KKDVDDDGEEKELMERLKKLSVPTSDEEDEVPAPKPRGGKKTKGGNVFAALIQDQSEEEEEEEKHPPKPAKPEKNRINKAVSEEQQPALKGKKGKEEKSKGKAKPQNKFAAL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ABCF1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ABCF1 Antibody (NBP1-89314)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ABCF1 |
![Immunocytochemistry/Immunofluorescence: ABCF1 Antibody [NBP1-89314] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ABCF1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89314-img0006.jpg "Immunocytochemistry/Immunofluorescence: ABCF1 Antibody [NBP1-89314] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ABCF1 Antibody [NBP1-89314] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/ABCF1-Antibody-Immunohistochemistry-Paraffin-NBP1-89314-img0012.jpg "Immunohistochemistry-Paraffin: ABCF1 Antibody [NBP1-89314] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot: ABCF1 Antibody [NBP1-89314] - Analysis in human cell lines Caco-2 and MCF-7 using anti-ABCF1 antibody. Corresponding ABCF1 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize/ABCF1-Antibody-Western-Blot-NBP1-89314-img0009.jpg "Western Blot: ABCF1 Antibody [NBP1-89314] - Analysis in human cell lines Caco-2 and MCF-7 using anti-ABCF1 antibody. Corresponding ABCF1 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.")
![Immunohistochemistry-Paraffin: ABCF1 Antibody [NBP1-89314] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/ABCF1-Antibody-Immunohistochemistry-Paraffin-NBP1-89314-img0010.jpg "Immunohistochemistry-Paraffin: ABCF1 Antibody [NBP1-89314] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: ABCF1 Antibody [NBP1-89314] - Staining of human pancreas shows weak to moderate cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/ABCF1-Antibody-Immunohistochemistry-Paraffin-NBP1-89314-img0011.jpg "Immunohistochemistry-Paraffin: ABCF1 Antibody [NBP1-89314] - Staining of human pancreas shows weak to moderate cytoplasmic positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: ABCF1 Antibody [NBP1-89314] - Staining of human rectum shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ABCF1-Antibody-Immunohistochemistry-Paraffin-NBP1-89314-img0013.jpg "Immunohistochemistry-Paraffin: ABCF1 Antibody [NBP1-89314] - Staining of human rectum shows moderate to strong cytoplasmic positivity in glandular cells.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")