![Immunocytochemistry/Immunofluorescence: XPF Antibody [NBP2-58407] - Staining of human cell line A-431 shows localization to nucleoplasm & cell junctions.](http://images.novusbio.com/fullsize/XPF-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58407-img0001.jpg "Immunocytochemistry/Immunofluorescence: XPF Antibody [NBP2-58407] - Staining of human cell line A-431 shows localization to nucleoplasm & cell junctions.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SKPQPDAATALAITADSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ERCC4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot Rad17 [p Ser645] Antibody](https://images.novusbio.com/images/Rad17-[p-Ser645]-Antibody-Western-Blot-NBP2-24457-img0001.jpg)
![Immunohistochemistry-Paraffin Rad17 [p Ser645] Antibody](https://images.novusbio.com/images/Rad17-[p-Ser645]-Antibody-Immunohistochemistry-Paraffin-NBP2-24457-img0003.jpg)
![Western Blot Rad17 [p Ser645] Antibody](https://images.novusbio.com/images/Rad17-[p-Ser645]-Antibody-Western-Blot-NBP2-24457-img0005.jpg)
| Publications using NBP2-58407 | Applications | Species |
|---|---|---|
| Kim S, Kang N, Ra J et al. Polyubiquitinated PCNA promotes alternative lengthening of telomeres by inducing break-induced replication bioRxiv 2023-07-14 | ||
| Kim S, Park SH, Kang N et al. Polyubiquitinated PCNA triggers SLX4-mediated break-induced replication in alternative lengthening of telomeres (ALT) cancer cells. Nucleic acids research 2024-09-18 [PMID: 39291733] |
Secondary Antibodies |
Isotype Controls |
Research Areas for XPF Antibody (NBP2-58407)Find related products by research area.
|
|
NER Antibodies in Cancer Research We at Novus Biologicals have over 230 products in our antibody catalog devoted to nucleotide excision repair. NER is a multi-stage sequential process involving over 30 proteins, all of which have been widely studied. Being the primary method to repair... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ERCC4 |
![Western Blot: XPF Antibody [NBP2-58407] -Analysis in human cell line EFO-21.](http://images.novusbio.com/fullsize/antibody/nbp2-58407_rabbit-polyclonal-xpf-antibody-western-blot-133202482238..jpg "Western Blot: XPF Antibody [NBP2-58407] -Analysis in human cell line EFO-21.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")