![Western Blot: UBE2Z Antibody [NBP1-82245] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/UBE2Z-Antibody-Western-Blot-NBP1-82245-img0012.jpg "Western Blot: UBE2Z Antibody [NBP1-82245] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UBE2Z |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UBE2Z |
![Immunocytochemistry/Immunofluorescence: UBE2Z Antibody [NBP1-82245] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize/UBE2Z-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82245-img0010.jpg "Immunocytochemistry/Immunofluorescence: UBE2Z Antibody [NBP1-82245] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.")
![Immunohistochemistry-Paraffin: UBE2Z Antibody [NBP1-82245] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts and moderate in Leydig cells.](http://images.novusbio.com/fullsize/UBE2Z-Antibody-Immunohistochemistry-Paraffin-NBP1-82245-img0011.jpg "Immunohistochemistry-Paraffin: UBE2Z Antibody [NBP1-82245] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts and moderate in Leydig cells.")
![Western Blot: UBE2Z Antibody [NBP1-82245] - Analysis in human cell line A-549.](http://images.novusbio.com/fullsize/UBE2Z-Antibody-Western-Blot-NBP1-82245-img0007.jpg "Western Blot: UBE2Z Antibody [NBP1-82245] - Analysis in human cell line A-549.")
![Western Blot: UBE2Z Antibody [NBP1-82245] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/UBE2Z-Antibody-Western-Blot-NBP1-82245-img0008.jpg "Western Blot: UBE2Z Antibody [NBP1-82245] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Simple Western: UBE2Z Antibody [NBP1-82245] - Simple Western lane view shows a specific band for UBE2Z in 0.2 mg/ml of NIH-3T3 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/UBE2Z-Antibody-Simple-Western-NBP1-82245-img0005.jpg "Simple Western: UBE2Z Antibody [NBP1-82245] - Simple Western lane view shows a specific band for UBE2Z in 0.2 mg/ml of NIH-3T3 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: UBE2Z Antibody [NBP1-82245] - Electropherogram image(s) of corresponding Simple Western lane view. UBE2Z antibody was used at 1:20 dilution on NIH-3T3 lysate(s).](http://images.novusbio.com/fullsize/UBE2Z-Antibody-Simple-Western-NBP1-82245-img0006.jpg "Simple Western: UBE2Z Antibody [NBP1-82245] - Electropherogram image(s) of corresponding Simple Western lane view. UBE2Z antibody was used at 1:20 dilution on NIH-3T3 lysate(s).")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")