![Western Blot: TRPA1 Antibody (6G8) [H00008989-M03] - Analysis of TRPA1 expression in transfected 293T cell line by TRPA1 monoclonal antibody (M03), clone 6G8. Lane 1: TRPA1 transfected lysate (Predicted MW: 123.09 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/TRPA1-Antibody-6G8-Western-Blot-H00008989-M03-img0004.jpg "Western Blot: TRPA1 Antibody (6G8) [H00008989-M03] - Analysis of TRPA1 expression in transfected 293T cell line by TRPA1 monoclonal antibody (M03), clone 6G8. Lane 1: TRPA1 transfected lysate (Predicted MW: 123.09 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | Hu, Mu, GpSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 6G8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | TRPA1 (NP_015628, 1033 a.a. ~ 1117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL |
| Specificity | TRPA1 - transient receptor potential cation channel, subfamily A, member 1 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TRPA1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
![Immunohistochemistry EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/EN-RAGE_AF1052_Immunohistochemistry_6671.jpg)
![Western Blot EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/ENRAGE_AF1052_Western_Blot_19098.jpg)
![Simple Western EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/af1052_human-en-rage-affinity-purified-polyclonal-ab-simple-western-2672021152820.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Guofeng Gao |
WB | Guinea Pig | 09/26/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for TRPA1 Antibody (H00008989-M03)Find related products by research area.
|
|
Winter is coming, and TRPM8 welcomes the cold! TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds. While TRPM8 is best known for its location in peripheral nerve endings, it has functio... Read full blog post. |
|
TRPA1: A contributor to itching and inflammation? Scratch that! Transient receptor potential A1 (TRPA1) is an ion channel found on the plasma membrane of many cell types that functions in diverse sensory processes such as pain and temperature. The TRPA1 ion channel is specifically expressed in nociceptive neurons,... Read full blog post. |
|
Touch Infographic: From Touch Receptors to the Brain The body contains thousands of receptors and nerves which allow us to experience the sense of touch, also referred to as tactile perception. The somatosensory system allows organisms to perceive and decode a wide range of tactile stimuli to allow for ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: TRPA1 Antibody (6G8) [H00008989-M03] - WB analysis of TRPA1 using anti-TRPA1 antibody on guinea pig nerve ganglia samples. Image from verified customer review.](http://images.novusbio.com/fullsize/TRPA1-Antibody-6G8-Western-Blot-H00008989-M03-img0001.jpg "Western Blot: TRPA1 Antibody (6G8) [H00008989-M03] - WB analysis of TRPA1 using anti-TRPA1 antibody on guinea pig nerve ganglia samples. Image from verified customer review.")
![ELISA: TRPA1 Antibody (6G8) [H00008989-M03] - Detection limit for recombinant GST tagged TRPA1 is 1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/TRPA1-Antibody-6G8-Sandwich-ELISA-H00008989-M03-img0003.jpg "ELISA: TRPA1 Antibody (6G8) [H00008989-M03] - Detection limit for recombinant GST tagged TRPA1 is 1 ng/ml as a capture antibody.")
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")
