![Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Analysis in human skin and cerebral cortex tissues. Corresponding TYRP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TYRP1-Antibody-Immunohistochemistry-Paraffin-NBP1-88370-img0012.jpg "Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Analysis in human skin and cerebral cortex tissues. Corresponding TYRP1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLH |
| Predicted Species | Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TYRP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Publications using NBP1-88370 | Applications | Species |
|---|---|---|
| Shridhar N Novel vaccination strategies for CD4+ T cell immunotherapy of melanoma Thesis (WB, Mouse) | WB | Mouse |
| Shridhar N Novel vaccination strategies for CD4+ T cell immunotherapy of melanoma Thesis (ICC/IF, Mouse) | ICC/IF | Mouse |
| Li MY, Flora P, Pu H Et al. UV-induced reduction in Polycomb repression promotes epidermal pigmentation Developmental cell 2021-08-30 [PMID: 34473941] | ||
| Mengoni M, Braun AD, Gaffal E, Tuting T C9orf72 in myeloid cells suppresses STING-induced inflammation Int. J. Cancer 2020-08-13 [PMID: 32790916] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for TYRP1 Antibody (NBP1-88370)Find related products by research area.
|
|
Winter is coming, and TRPM8 welcomes the cold! TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds. While TRPM8 is best known for its location in peripheral nerve endings, it has functio... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TYRP1 |
![Western Blot: TYRP1 Antibody [NBP1-88370] - Analysis in control (vector only transfected HEK293T lysate) and TYRP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/TYRP1-Antibody-Western-Blot-NBP1-88370-img0011.jpg "Western Blot: TYRP1 Antibody [NBP1-88370] - Analysis in control (vector only transfected HEK293T lysate) and TYRP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunocytochemistry/Immunofluorescence: TYRP1 Antibody [NBP1-88370] - Staining of human cell line SK-MEL-30 shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TYRP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88370-img0005.jpg "Immunocytochemistry/Immunofluorescence: TYRP1 Antibody [NBP1-88370] - Staining of human cell line SK-MEL-30 shows localization to vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/TYRP1-Antibody-Immunohistochemistry-Paraffin-NBP1-88370-img0016.jpg "Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Western Blot: TYRP1 Antibody [NBP1-88370] - Analysis in human cell line SK-MEL-30.](http://images.novusbio.com/fullsize/TYRP1-Antibody-Western-Blot-NBP1-88370-img0007.jpg "Western Blot: TYRP1 Antibody [NBP1-88370] - Analysis in human cell line SK-MEL-30.")
![Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/TYRP1-Antibody-Immunohistochemistry-Paraffin-NBP1-88370-img0013.jpg "Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human rectum shows moderate to strong cytoplasmic positivity in a subset of glandular cells and cells in stroma.](http://images.novusbio.com/fullsize/TYRP1-Antibody-Immunohistochemistry-Paraffin-NBP1-88370-img0014.jpg "Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human rectum shows moderate to strong cytoplasmic positivity in a subset of glandular cells and cells in stroma.")
![Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human skin shows moderate to strong cytoplasmic positivity in melanocytes.](http://images.novusbio.com/fullsize/TYRP1-Antibody-Immunohistochemistry-Paraffin-NBP1-88370-img0015.jpg "Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human skin shows moderate to strong cytoplasmic positivity in melanocytes.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")