Home » STEP » STEP Proteins » STEP Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

STEP Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for STEP Recombinant Protein Antigen (NBP2-58008PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

STEP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STEP.

Source: E. coli

Amino Acid Sequence: EHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTPN5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58008.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for STEP Recombinant Protein Antigen

  • EC 3.1.3.48
  • FLJ14427
  • Neural-specific protein-tyrosine phosphatase
  • protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)
  • protein-tyrosine phosphatase striatum-enriched
  • PTPN5
  • STEP
  • STEPPTPSTEP
  • Striatum-enriched protein-tyrosine phosphatase
  • tyrosine-protein phosphatase non-receptor type 5

Background

The protein tyrosine phosphatase non-receptor type 5 or striatum-enriched protein-tyrosine phosphatase (STEP) protein is part of a family of protein tyrosine phosphatases enriched within the CNS, and is a key component of the NMDAR complex. It is expressed within dopaminoceptive neurons in the CNS and particularly enriched within the basal ganglia and related structures. STEP61 is the membrane-associated isoform and STEP46 is the cytosolic protein. In response to transient hypoxia-ischemia in the brain, STEP61 is proteolytically cleaved by calpain, thereby releasing a smaller isoform, STEP33.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NMDAR2B Antibody
NB300-106
Western Blot NMDAR2B Antibody
Flow Cytometry NMDAR2B Antibody
Western Blot NMDAR2B Antibody
(3 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
p38 gamma/SAPK3
Antibody [Unconjugate
AF1347
Immunocytochemistry p38 gamma/SAPK3 Antibody [Unconjugated]
Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]
Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]
(8 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western p38 alpha Antibody [Unconjugated]
Western Blot p38 alpha Antibody [Unconjugated]
Immunohistochemistry p38 alpha Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
PCPTP1 Antibody
NBP1-84912
Immunohistochemistry-Paraffin PCPTP1 Antibody
Immunohistochemistry-Paraffin PCPTP1 Antibody
Immunohistochemistry-Paraffin PCPTP1 Antibody
Species: Hu
Applications: IHC, IHC-P
Fyn Antibody
(FYN-01) - BSA Free
NB500-517
Immunoprecipitation Fyn Antibody (FYN-01) - BSA Free
Immunocytochemistry/ Immunofluorescence Fyn Antibody (FYN-01) - BSA Free
Immunocytochemistry/ Immunofluorescence Fyn Antibody (FYN-01) - BSA Free
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
GluR2 Antibody
(JU20-43)
NBP2-75510
Immunocytochemistry/ Immunofluorescence GluR2 Antibody (JU20-43)
Immunocytochemistry/ Immunofluorescence GluR2 Antibody (JU20-43)
Immunohistochemistry-Paraffin GluR2 Antibody (JU20-43)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Reg1A Antibody
(431202) [Unconjugate
MAB4937
Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Crk Antibody
(3G11E8) - BSA Free
NBP2-37568
ELISA Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
POLDIP2 Antibody
NBP1-68874
Western Blot POLDIP2 Antibody
Western Blot POLDIP2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
PTP pi/PTPRU
Antibody (764209)
MAB7475
Western Blot PTP pi/PTPRU Antibody (764209)
Western Blot PTP pi/PTPRU Antibody (764209)
(4 Publications)
Species: Hu, Rt
Applications: WB
AHSA1 Antibody
(1A2-A8)
H00010598-M01
Western Blot AHSA1 Antibody (1A2-A8)
Sandwich ELISA AHSA1 Antibody (1A2-A8)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
GRAP2 Antibody
(OTI1G2)
NBP2-00764
Flow Cytometry GRAP2 Antibody (OTI1G2)
Flow Cytometry GRAP2 Antibody (OTI1G2)
Western Blot GRAP2 Antibody (OTI1G2)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AIMP2 Antibody
NBP1-81575
Immunohistochemistry-Paraffin AIMP2 Antibody
Immunohistochemistry-Paraffin AIMP2 Antibody
Immunohistochemistry-Paraffin AIMP2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SLC25A3 Antibody
H00005250-B02P
Immunocytochemistry/ Immunofluorescence SLC25A3 Antibody
Western Blot SLC25A3 Antibody
Western Blot SLC25A3 Antibody
Species: Hu
Applications: ICC/IF, WB
NMDAR1 Antibody
(R1JHL) - Azide and B ...
NB300-118
Western Blot NMDAR1 Antibody (R1JHL) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence NMDAR1 Antibody (R1JHL) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence NMDAR1 Antibody (R1JHL) - Azide and BSA Free
(14 Reviews)
(21 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
STEP Recombinant
Protein Antigen
NBP2-58008PEP
STEP Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for STEP Recombinant Protein Antigen (NBP2-58008PEP) (0)

There are no publications for STEP Recombinant Protein Antigen (NBP2-58008PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STEP Recombinant Protein Antigen (NBP2-58008PEP) (0)

There are no reviews for STEP Recombinant Protein Antigen (NBP2-58008PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STEP Recombinant Protein Antigen (NBP2-58008PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STEP Products

Research Areas for STEP Recombinant Protein Antigen (NBP2-58008PEP)

Find related products by research area.

Blogs on STEP

There are no specific blogs for STEP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry-Paraffin: STEP Antibody (23E5) [NB300-202] - STEP was detected in immersion fixed paraffin-embedded sections of human brain basal ganglia using Mouse Anti-Human STEP (23E5) Monoclonal Antibody (Catalog # NB300-202) at 1:100 for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm in neurons.
STEP Antibody (23E5)
NB300-202
Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
EphB2 Antibody [Unconjugated]
AF467

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STEP Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PTPN5