Home » SOX11 » SOX11 Antibodies » SOX11 Antibody
Novus Biologicals products are now on bio-techne.com

SOX11 Antibody

 (20 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: SOX11 Antibody [NBP1-85823] - Analysis in human cell line SH-SY5Y.
Western Blot: SOX11 Antibody [NBP1-85823] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: SOX11 Antibody [NBP1-85823] - Staining of human chronic lymphocytic leukemia shows no nuclear positivity in tumor cells as expected.
Immunohistochemistry-Paraffin: SOX11 Antibody [NBP1-85823] - Staining of human mantle cell lymphoma shows moderate to strong nuclear positivity in tumor cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SOX11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOX11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation (ChIP) Reported in scientific literature (PMID: 24681958)
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SOX11 Protein (NBP1-85823PEP)
Publications
Read Publications using
NBP1-85823 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SOX11 Antibody

  • SOX11
  • SRY (sex determining region Y)-box 11
  • SRY (sex-determining region Y)-box 11
  • SRY-related HMG-box gene 11
  • transcription factor SOX-11

Background

SOX11 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SOX4 Antibody
(CL5665)
NBP2-61421
Immunohistochemistry-Paraffin SOX4 Antibody (CL5665)
Immunohistochemistry-Paraffin SOX4 Antibody (CL5665)
Immunocytochemistry/ Immunofluorescence SOX4 Antibody (CL5665)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
(1 Review)
(9 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(354 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
SOX9 Antibody
[Unconjugated]
AF3075
Immunocytochemistry SOX9 Antibody [Unconjugated]
Western Blot SOX9 Antibody [Unconjugated]
Immunocytochemistry SOX9 Antibody [Unconjugated]
(2 Reviews)
(146 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
SOX3 Antibody
[Unconjugated]
AF2569
Immunocytochemistry SOX3 Antibody [Unconjugated]
Immunocytochemistry SOX3 Antibody [Unconjugated]
(13 Publications)
Species: Hu
Applications: ICC, WB
SRY Antibody (1G4)
- BSA Free
NBP2-37463
ELISA SRY Antibody (1G4) - BSA Free
Western Blot SRY Antibody (1G4) - BSA Free
Western Blot SRY Antibody (1G4) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
SOX15 Antibody
[Unconjugated]
AF4070
Western Blot SOX15 Antibody [Unconjugated]
Immunocytochemistry SOX15 Antibody [Unconjugated]
Immunocytochemistry SOX15 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ICC, WB
Recombinant Human
SOX22 GST (N-Term) Pr ...
H00006666-Q01
SDS-PAGE Recombinant Human SOX22 GST (N-Term) Protein
(1 Publication)
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Fumarase Antibody
NBP1-31336
Immunocytochemistry/ Immunofluorescence Fumarase Antibody
Western Blot Fumarase Antibody
Western Blot Fumarase Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
CLEC4D/CLECSF8
Antibody (413512)
MAB2806
Flow Cytometry CLEC4D/CLECSF8 Antibody (413512)
(2 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
SOX10 Antibody
[Unconjugated]
AF2864
Immunocytochemistry SOX10 Antibody [Unconjugated]
Immunocytochemistry SOX10 Antibody [Unconjugated]
Immunohistochemistry SOX10 Antibody [Unconjugated]
(2 Reviews)
(115 Publications)
Species: Hu
Applications: ICC, IHC, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Recombinant Human
TEAD2 GST (N-Term) Pr ...
H00008463-P01
Other Recombinant Human TEAD2 GST (N-Term) Protein
(1 Publication)
Species: Hu
Applications: ELISA, AP, PA, WB
SOX5 Antibody
AF5286
Western Blot SOX5 Antibody
(1 Publication)
Species: Hu
Applications: WB
POU3F3 Antibody
NBP1-49872
Western Blot POU3F3 Antibody
Immunocytochemistry/ Immunofluorescence POU3F3 Antibody
Flow Cytometry POU3F3 Antibody
(1 Review)
(9 Publications)
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
SOX21 Antibody
[Unconjugated]
AF3538
Immunocytochemistry SOX21 Antibody [Unconjugated]
Immunohistochemistry SOX21 Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: ICC, IHC, WB
ATF3 Antibody
NBP1-85816
Immunohistochemistry-Paraffin ATF3 Antibody
Immunohistochemistry-Paraffin ATF3 Antibody
Immunohistochemistry-Paraffin ATF3 Antibody
(3 Reviews)
(30 Publications)
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
SOX8 Antibody
NBP3-12898
Western Blot SOX8 Antibody
Western Blot SOX8 Antibody
Immunohistochemistry-Paraffin SOX8 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SOX1 Antibody
[Unconjugated]
AF3369
Western Blot SOX1 Antibody [Unconjugated]
Simple Western SOX1 Antibody [Unconjugated]
Immunocytochemistry SOX1 Antibody [Unconjugated]
(129 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
SOX11 Antibody
NBP1-85823
SOX11 Antibody
Species: Hu
Applications: WB, IHC, ChIP

Publications for SOX11 Antibody (NBP1-85823)(20)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: Chemotaxis, IF/IHC, WB.


Filter By Application
Chemotaxis
(1)
IF/IHC
(4)
WB
(1)
All Applications
Filter By Species
Human
(3)
All Species
Showing Publications 1 - 10 of 20. Show All 20 Publications.
Publications using NBP1-85823 Applications Species
Righi S, Pileri S, Agostinelli C et al. Reproducibility of SOX-11 detection in decalcified bone marrow tissue in mantle cell lymphoma patients. Hum. Pathol. 2016-10-05 [PMID: 27720733] (IF/IHC) IF/IHC
Inmaculada Ribera-Cortada, Daniel Martinez, Virginia Amador et al. Plasma cell and terminal B-cell differentiation in mantle cell lymphoma mainly occur in the SOX11-negative subtype. Modern Pathology 2015-09-11 [PMID: 26360498] (IF/IHC, Human) IF/IHC Human
Davidson B, Holth A, Hellesylt E et al. The clinical role of epithelial-mesenchymal transition and stem cell markers in advanced-stage ovarian serous carcinoma effusions. Hum Pathol 2015-01-01 [PMID: 25455994] (IF/IHC, Human) IF/IHC Human
Kuo PY, Leshchenko VV, Fazzari MJ et al. High resolution Chromatin Immunoprecipitation (Chromatin Immunoprecipitation) sequencing reveals novel bindings targets and prognostic role for SOX11 in Mantle cell lymphoma. Oncogene 2015-03-05 [PMID: 24681958] (IF/IHC, WB, Chemotaxis, Human) IF/IHC, WB, Chemotaxis Human
Nygren L, Baumgartner Wennerholm S, Klimkowska M et al. Prognostic role of SOX11 in a population-based cohort of mantle cell lymphoma. Blood 2012-05-01 [PMID: 22431568]
Carvajal-Cuenca A, Sua LF, Silva NM et al. In situ mantle cell lymphoma: clinical implications of an incidental finding with indolent clinical behavior. Haematologica 2012-02-01 [PMID: 22058203]
Sernbo S, Gustavsson E, Brennan DJ et al. The tumour suppressor SOX11 is associated with improved survival among high grade epithelial ovarian cancers and is regulated by reversible promoter methylation. BMC Cancer 2011-09-01 [PMID: 21943380]
Kimura Y, Sato K, Imamura Y et al. Small cell variant of mantle cell lymphoma is an indolent lymphoma characterized by bone marrow involvement, splenomegaly, and a low Ki-67 index. Cancer Sci 2011-09-01 [PMID: 21609366]
Ondrejka SL, Lai R, Smith SD et al. Indolent mantle cell leukemia: a clinicopathological variant characterized by isolated lymphocytosis, interstitial bone marrow involvement, kappa light chain restriction, and good prognosis. Haematologica 2011-08-01 [PMID: 21508124]
Cao X, Fan L, Fang C et al. The expression of SOX11, cyclin D1, cyclin D2, and cyclin D3 in B-cell lymphocytic proliferative diseases. Med Oncol 2012-06-01 [PMID: 21479697]
Show All 20 Publications.

Reviews for SOX11 Antibody (NBP1-85823) (0)

There are no reviews for SOX11 Antibody (NBP1-85823). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX11 Antibody (NBP1-85823) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOX11 Products

Blogs on SOX11.

Check out the latest blog posts on SOX11.
SOX-11 seals your fate
The SOX-11 transcription factor is a member of the SOX family known to be involved in embryonic development regulation and cell fate determination. The protein acts as a transcriptional regulator and appears to modulate fundamental aspects of normal e...  Read full blog post.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX11 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SOX11