Home » SOX22 » SOX22 Proteins » Recombinant Human SOX22 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human SOX22 GST (N-Term) Protein

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human SOX22 Protein [H00006666-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human SOX22 Protein [H00006666-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human SOX22 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 252-313 of Human SOX22

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SOX12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
32.56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00006666-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SOX22 GST (N-Term) Protein

  • Protein SOX-22
  • SOX-22 protein
  • SOX22transcription factor SOX-12
  • SRY (sex determining region Y)-box 12
  • SRY (sex determining region Y)-box 22
  • SRY-related HMG-box gene 22

Background

SOX12 - SRY (sex determining region Y)-box 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SOX11 Antibody
NBP2-31371
Western Blot SOX11 Antibody
Immunohistochemistry-Paraffin SOX11 Antibody
Immunocytochemistry/ Immunofluorescence SOX11 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SOX4 Antibody
(CL5665)
NBP2-61421
Immunohistochemistry-Paraffin SOX4 Antibody (CL5665)
Immunohistochemistry-Paraffin SOX4 Antibody (CL5665)
Immunocytochemistry/ Immunofluorescence SOX4 Antibody (CL5665)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
SRY Antibody (1G4)
- BSA Free
NBP2-37463
ELISA SRY Antibody (1G4) - BSA Free
Western Blot SRY Antibody (1G4) - BSA Free
Western Blot SRY Antibody (1G4) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Recombinant Human
TEAD2 GST (N-Term) Pr ...
H00008463-P01
Other Recombinant Human TEAD2 GST (N-Term) Protein
(1 Publication)
Species: Hu
Applications: ELISA, AP, PA, WB
SOX15 Antibody
[Unconjugated]
AF4070
Western Blot SOX15 Antibody [Unconjugated]
Immunocytochemistry SOX15 Antibody [Unconjugated]
Immunocytochemistry SOX15 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ICC, WB
Exosome component
1 Antibody (OTI1H9)
NBP2-45545
Immunohistochemistry Exosome component 1 Antibody (OTI1H9)
Immunohistochemistry Exosome component 1 Antibody (OTI1H9)
Immunohistochemistry Exosome component 1 Antibody (OTI1H9)
Species: Hu, Mu, Rt
Applications: IHC, WB
Steroid sulfatase
Antibody
NBP1-90095
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P
Galectin-4
Antibody [Unconjugate
AF2128
Immunohistochemistry Galectin-4 Antibody [Unconjugated]
(5 Publications)
Species: Mu
Applications: IHC, WB
SOX5 Antibody
AF5286
Western Blot SOX5 Antibody
(1 Publication)
Species: Hu
Applications: WB
SOX10 Antibody
[Unconjugated]
AF2864
Immunocytochemistry SOX10 Antibody [Unconjugated]
Immunocytochemistry SOX10 Antibody [Unconjugated]
Immunohistochemistry SOX10 Antibody [Unconjugated]
(2 Reviews)
(115 Publications)
Species: Hu
Applications: ICC, IHC, WB
SOX9 Antibody
[Unconjugated]
AF3075
Immunocytochemistry SOX9 Antibody [Unconjugated]
Western Blot SOX9 Antibody [Unconjugated]
Immunocytochemistry SOX9 Antibody [Unconjugated]
(2 Reviews)
(146 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(354 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
SOX1 Antibody
[Unconjugated]
AF3369
Western Blot SOX1 Antibody [Unconjugated]
Simple Western SOX1 Antibody [Unconjugated]
Immunocytochemistry SOX1 Antibody [Unconjugated]
(129 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
SOX3 Antibody
[Unconjugated]
AF2569
Immunocytochemistry SOX3 Antibody [Unconjugated]
Immunocytochemistry SOX3 Antibody [Unconjugated]
(13 Publications)
Species: Hu
Applications: ICC, WB
SOX14 Antibody -
BSA Free
NBP2-94603
Immunocytochemistry/ Immunofluorescence SOX14 Antibody - BSA Free
Western Blot SOX14 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
SETMAR Antibody
NBP2-58313
Western Blot SETMAR Antibody
Immunocytochemistry/ Immunofluorescence SETMAR Antibody
Species: Hu
Applications: ICC/IF, WB
Drebrin 1 Antibody
(838102) [Unconjugate ...
MAB7739
Simple Western Drebrin 1 Antibody (838102) [Unconjugated]
Immunocytochemistry Drebrin 1 Antibody (838102) [Unconjugated]
Western Blot Drebrin 1 Antibody (838102) [Unconjugated]
Species: Hu
Applications: ICC, Simple Western, WB
CLEC4D/CLECSF8
Antibody (413512)
MAB2806
Flow Cytometry CLEC4D/CLECSF8 Antibody (413512)
(2 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB

Publications for SOX22 Partial Recombinant Protein (H00006666-Q01)(1)


Reviews for SOX22 Partial Recombinant Protein (H00006666-Q01) (0)

There are no reviews for SOX22 Partial Recombinant Protein (H00006666-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX22 Partial Recombinant Protein (H00006666-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SOX22 Products

Array H00006666-Q01

Blogs on SOX22

There are no specific blogs for SOX22, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Western blot shows lysates of D3 mouse embryonic stem cell line, NTera-2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF017). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX2 Antibody [Unconjugated]
AF2018
SOX9 was detected in immersion fixed BG01V human embryonic stem cells differentiated into early proximal lung progenitor cells using Goat Anti-Human SOX9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3075) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; NL001) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
SOX9 Antibody [Unconjugated]
AF3075

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SOX22 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SOX12