![Western Blot: Smad2 Antibody [NBP3-02957] - Western blot analysis of extracts from normal (control) and Smad2 knockout (KO) HeLa cells, using Smad2 antibody (NBP3-02957) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5min.](http://images.novusbio.com/fullsize/Smad2-Antibody-Western-Blot-NBP3-02957-img0005.jpg "Western Blot: Smad2 Antibody [NBP3-02957] - Western blot analysis of extracts from normal (control) and Smad2 knockout (KO) HeLa cells, using Smad2 antibody (NBP3-02957) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5min.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Smad2 (NP_005892.1). MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SMAD2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 52 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Smad2 Antibody (NBP3-02957)Find related products by research area.
|
|
TGF-beta for treating degenerative intervertebral disc disease By Jamshed Arslan Pharm.D. Our upright posture and balance depend on a jelly-like material, called nucleus pulposus (NP), in the middle of intervertebral discs. NP cells protect us from disc degeneration by maintain... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SMAD2 |
![Immunocytochemistry/Immunofluorescence: Smad2 Antibody [NBP3-02957] - Immunofluorescence analysis of NIH/3T3 cells using Smad2 antibody (NBP3-02957) at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Smad2-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-02957-img0003.jpg "Immunocytochemistry/Immunofluorescence: Smad2 Antibody [NBP3-02957] - Immunofluorescence analysis of NIH/3T3 cells using Smad2 antibody (NBP3-02957) at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Smad2 Antibody [NBP3-02957] - Immunohistochemistry of paraffin-embedded Human colon carcinoma using [KO Validated] Smad2 Rabbit pAb (NBP3-02957) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Smad2-Antibody-Immunohistochemistry-Paraffin-NBP3-02957-img0004.jpg "Immunohistochemistry-Paraffin: Smad2 Antibody [NBP3-02957] - Immunohistochemistry of paraffin-embedded Human colon carcinoma using [KO Validated] Smad2 Rabbit pAb (NBP3-02957) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Western Blot: Smad2 Antibody [NBP3-02957] - Western blot analysis of extracts of HT-1080 cells, using Smad2 antibody (NBP3-02957) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/Smad2 Antibody-Western Blot-NBP3-02957-img0006.jpg "Western Blot: Smad2 Antibody [NBP3-02957] - Western blot analysis of extracts of HT-1080 cells, using Smad2 antibody (NBP3-02957) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.")
![Immunocytochemistry/Immunofluorescence: Smad2 Antibody [NBP3-02957] - Analysis of HeLa cells using Smad2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Smad2-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-02957-img0001.jpg "Immunocytochemistry/Immunofluorescence: Smad2 Antibody [NBP3-02957] - Analysis of HeLa cells using Smad2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: Smad2 Antibody [NBP3-02957] - Analysis of PC-12 cells using Smad2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Smad2-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-02957-img0002.jpg "Immunocytochemistry/Immunofluorescence: Smad2 Antibody [NBP3-02957] - Analysis of PC-12 cells using Smad2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Chromatin Immunoprecipitation (ChIP) Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Chromatin_Immunoprecipitation_11225.jpg)
![Western Blot Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Western_Blot_17168.jpg)
![Immunocytochemistry Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Immunocytochemistry__Immunofluorescence_17807.jpg)
![Western Blot Smad7 Antibody (293039) [Unconjugated]](https://images.novusbio.com/images2/Smad7_MAB2029_Western_Blot_6004.jpg)
![Immunohistochemistry Smad7 Antibody (293039) [Unconjugated]](https://images.novusbio.com/images2/Smad7_MAB2029_Immunohistochemistry_6962.jpg)
![Immunohistochemistry Smad7 Antibody (293039) [Unconjugated]](https://images.novusbio.com/images2/Smad7_MAB2029_Immunohistochemistry_9846.jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGFbeta_RI_AF3025_Western_Blot_17081.jpg)
![Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RI_AF3025_Immunocytochemistry_9948.jpg)
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images/af3025_human-tgf-beta-ri-alk-5-affinity-purified-polyclonal-ab-41202412402510.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Immunohistochemistry_10106.jpg)
![Western Blot Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Western_Blot_5162.jpg)
![Simple Western Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Simple_Western_16677.jpg)
![Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CTGF_AF660_Immunohistochemistry_9968.jpg)
![Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CTGF_AF660_Immunohistochemistry_9969.jpg)
![Western Blot CTGF/CCN2 Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images/af660_human-ctgf-ccn2-c-terminus-affinity-purified-polyclonal-ab-822024951141.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")